SLC30A6 Antibody


Western Blot: SLC30A6 Antibody [NBP2-31673] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: SLC30A6 Antibody [NBP2-31673] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: SLC30A6 Antibody [NBP2-31673] - Staining of human hippocampus shows distinct positivity in neuropil.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

SLC30A6 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: NVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP
Specificity of human SLC30A6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC30A6 Protein (NBP2-31673PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC30A6 Antibody

  • MGC45055
  • MST103
  • MSTP103
  • solute carrier family 30 (zinc transporter), member 6
  • Solute carrier family 30 member 6
  • zinc transporter 6
  • znT-6
  • ZNT6FLJ31101


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KO
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SLC30A6 Antibody (NBP2-31673) (0)

There are no publications for SLC30A6 Antibody (NBP2-31673).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC30A6 Antibody (NBP2-31673) (0)

There are no reviews for SLC30A6 Antibody (NBP2-31673). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC30A6 Antibody (NBP2-31673) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC30A6 Antibody (NBP2-31673)

Discover related pathways, diseases and genes to SLC30A6 Antibody (NBP2-31673). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC30A6 Antibody (NBP2-31673)

Discover more about diseases related to SLC30A6 Antibody (NBP2-31673).

Pathways for SLC30A6 Antibody (NBP2-31673)

View related products by pathway.

Blogs on SLC30A6

There are no specific blogs for SLC30A6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC30A6 Antibody and receive a gift card or discount.


Gene Symbol SLC30A6