SLC30A6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC30A6 Antibody [NBP2-31673] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: SLC30A6 Antibody [NBP2-31673] - Staining of human hippocampus shows distinct positivity in neuropil.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC30A6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC30A6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC30A6 Protein (NBP2-31673PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC30A6 Antibody

  • MGC45055
  • MST103
  • MSTP103
  • solute carrier family 30 (zinc transporter), member 6
  • Solute carrier family 30 member 6
  • zinc transporter 6
  • znT-6
  • ZNT6FLJ31101

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86824
Species: Hu
Applications: IHC, IHC-P
NBP1-82299
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80578
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31825
Species: Hu
Applications: IHC, IHC-P
NBP2-06015
Species: Hu
NBP1-76498
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-59357
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
MAB1448
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-88261
Species: Hu
Applications: IHC, IHC-P
AF7318
Species: Hu
Applications: IHC
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00000265-M03
Species: Hu
Applications: WB, ELISA
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31673
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SLC30A6 Antibody (NBP2-31673) (0)

There are no publications for SLC30A6 Antibody (NBP2-31673).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC30A6 Antibody (NBP2-31673) (0)

There are no reviews for SLC30A6 Antibody (NBP2-31673). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC30A6 Antibody (NBP2-31673) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC30A6 Products

Bioinformatics Tool for SLC30A6 Antibody (NBP2-31673)

Discover related pathways, diseases and genes to SLC30A6 Antibody (NBP2-31673). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC30A6 Antibody (NBP2-31673)

Discover more about diseases related to SLC30A6 Antibody (NBP2-31673).
 

Pathways for SLC30A6 Antibody (NBP2-31673)

View related products by pathway.

Blogs on SLC30A6

There are no specific blogs for SLC30A6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC30A6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC30A6
Uniprot