DNA Ligase III Antibody - Azide and BSA Free

Images

 
Western Blot: DNA Ligase III Antibody [NBP2-92719] - Analysis of extracts of various cell lines, using at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug ...read more
Immunocytochemistry/ Immunofluorescence: DNA Ligase III Antibody [NBP2-92719] - Analysis of PC-12 cells using LIG3 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP2-92719] - Immunohistochemistry of paraffin-embedded human colon using DNA Ligase III Rabbit pAb (NBP2-92719) at dilution of 1:100 (40x lens). Perform microwave ...read more
Immunocytochemistry/ Immunofluorescence: DNA Ligase III Antibody [NBP2-92719] - Analysis of NIH/3T3 cells using LIG3 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP2-92719] - Mouse kidney using LIG3 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before ...read more
Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP2-92719] - Rat brain using LIG3 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before ...read more
Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP2-92719] - Rat liver using LIG3 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before ...read more
Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP2-92719] - Rat ovary using LIG3 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

DNA Ligase III Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 254-460 of human DNA Ligase III (NP_039269.2). CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIG3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.05% Proclin 300
Purity
Affinity purified

Alternate Names for DNA Ligase III Antibody - Azide and BSA Free

  • DNA ligase 3
  • DNA Ligase III
  • EC 6.5.1.1
  • LIG2
  • LIG3
  • ligase II, DNA, ATP-dependent
  • ligase III, DNA, ATP-dependent
  • Polydeoxyribonucleotide synthase [ATP] 3

Background

DNA Ligase III is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and is located in both the mitochondria and nucleus, with translation initiation from the upstream start codon allowing for transport to the mitochondria and translation initiation from a downstream start codon allowing for transport to the nucleus. Additionally, alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87154
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-16182
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92719
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-119
Species: Ba, Ch, Fi, Ha, Hu, Mu, Rb
Applications: ICC/IF, IHC-P, IP, In vitro, RIA, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
NBP2-38600
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NB100-106
Species: Hu, Mu, Po, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-94064
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-74611
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-119
Species: Ba, Ch, Fi, Ha, Hu, Mu, Rb
Applications: ICC/IF, IHC-P, IP, In vitro, RIA, WB
AF3296
Species: Hu, Mu, Rt
Applications: WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89463
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00004595-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
NB500-704
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002189-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, KD, WB
MAB2476
Species: Hu
Applications: IHC, WB
H00007516-M01
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for DNA Ligase III Antibody (NBP2-92719) (0)

There are no publications for DNA Ligase III Antibody (NBP2-92719).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Ligase III Antibody (NBP2-92719) (0)

There are no reviews for DNA Ligase III Antibody (NBP2-92719). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNA Ligase III Antibody (NBP2-92719) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNA Ligase III Products

Diseases for DNA Ligase III Antibody (NBP2-92719)

Discover more about diseases related to DNA Ligase III Antibody (NBP2-92719).
 

Pathways for DNA Ligase III Antibody (NBP2-92719)

View related products by pathway.

PTMs for DNA Ligase III Antibody (NBP2-92719)

Learn more about PTMs related to DNA Ligase III Antibody (NBP2-92719).
 

Research Areas for DNA Ligase III Antibody (NBP2-92719)

Find related products by research area.

Blogs on DNA Ligase III.

PARP Antibody Assays aid both Apoptosis and Cancer Research
The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA Ligase III Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol LIG3