DLC1 Antibody

Images

 
Western Blot: DLC1 Antibody [NBP1-88824] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: DLC1 Antibody [NBP1-88824] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: DLC1 Antibody [NBP1-88824] - Staining of human duodenum shows distinct positivity of microvilli in glandular cells.
Western Blot: DLC1 Antibody [NBP1-88824] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DLC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DLC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500-1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DLC1 Protein (NBP1-88824PEP)
Publications
Read Publication using NBP1-88824.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22139079)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DLC1 Antibody

  • ARHGAP7 STARD12 deleted in liver cancer 1 variant 2
  • Deleted in liver cancer 1 protein
  • deleted in liver cancer 1
  • DLC-1
  • FLJ21120
  • HP protein
  • HP
  • KIAA1723
  • p122-RhoGAP
  • rho GTPase-activating protein 7
  • Rho-GTPase-activating protein 7
  • Rho-type GTPase-activating protein 7
  • StARD12
  • StAR-related lipid transfer (START) domain containing 12
  • StAR-related lipid transfer protein 12
  • START domain-containing protein 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-12553
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-89479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DLC1 Antibody (NBP1-88824)(1)

Reviews for DLC1 Antibody (NBP1-88824) (0)

There are no reviews for DLC1 Antibody (NBP1-88824). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DLC1 Antibody (NBP1-88824) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DLC1 Products

Bioinformatics Tool for DLC1 Antibody (NBP1-88824)

Discover related pathways, diseases and genes to DLC1 Antibody (NBP1-88824). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLC1 Antibody (NBP1-88824)

Discover more about diseases related to DLC1 Antibody (NBP1-88824).
 

Pathways for DLC1 Antibody (NBP1-88824)

View related products by pathway.

PTMs for DLC1 Antibody (NBP1-88824)

Learn more about PTMs related to DLC1 Antibody (NBP1-88824).

Blogs on DLC1

There are no specific blogs for DLC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DLC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DLC1