DLC1 Antibody - BSA Free

Western Blot: DLC1 Antibody [NBP1-88824] - Analysis in human cell line U-2197.

Immunocytochemistry/Immunofluorescence: DLC1 Antibody [NBP1-88824] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles.

Immunohistochemistry-Paraffin: DLC1 Antibody [NBP1-88824] - Staining of human duodenum shows distinct positivity of microvilli in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DLC1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DLC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500-1:5000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DLC1 Recombinant Protein Antigen (NBP1-88824PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DLC1 Antibody - BSA Free

• ARHGAP7 STARD12 deleted in liver cancer 1 variant 2
• Deleted in liver cancer 1 protein
• deleted in liver cancer 1
• DLC-1
• FLJ21120
• HP protein
• HP
• KIAA1723
• p122-RhoGAP
• rho GTPase-activating protein 7
• Rho-GTPase-activating protein 7
• Rho-type GTPase-activating protein 7
• StARD12
• StAR-related lipid transfer (START) domain containing 12
• StAR-related lipid transfer protein 12
• START domain-containing protein 12

Background

DLC1 is deleted in the primary tumor of hepatocellular carcinoma. It maps to 8p22-p21.3, a region frequently deleted in solid tumors. It is suggested that this gene is a candidate tumor suppressor gene for human liver cancer, as well as for prostate, lung, colorectal, and breast cancers. Alternative splicing at this locus results in several transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DLC1 Antibody (NBP1-88824)(1)

Publication using NBP1-88824

• Muehlich S, Hampl V, Khalid S et al. The transcriptional coactivators megakaryoblastic leukemia 1/2 mediate the effects of loss of the tumor suppressor deleted in liver cancer 1. Oncogene 2012-08-30 [PMID: 22139079]

Bioinformatics

• Gene Symbol: DLC1