DHX36 Antibody - BSA Free

Staining of human cell line EFO-21 shows localization to nucleoplasm & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DHX36 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DHX36 Antibody - BSA Free (NBP3-24787) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein DHX36 using the following amino acid sequence: VVEYLLEDVIEKIRYVPEQKEHRSQFKRGFMQGHVNRQEKEEKEAIYKERWPDYVRELRRRYSASTVDVIEMMEDDKVDLNLIVALIR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DHX36
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DHX36 Antibody - BSA Free

• DDX36
• DEAH (Asp-Glu-Ala-His) box polypeptide 36
• DEAH box protein 36
• EC 3.6.1
• EC 3.6.4.13
• G4 resolvase-1
• KIAA1488G4R1
• MLEL1RHAUDEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 36
• MLE-like protein 1
• probable ATP-dependent RNA helicase DHX36
• RNA helicase associated with AU-rich element ARE

Background

DHX36, also known as Probable ATP-dependent RNA helicase DHX36, consists of three isoforms of sizes 114.7 kDa, 113.2 kDa, and 111.5 kDa and is involved in breaking down mRNA with the ARE element in their 3'-UTR strand. Current research links this protein to sex development and spermatogenesis. The protein interacts with RPS9, AGO1, UBC, AGO2, and PHB in the RNA degradation pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DHX36