NTPCR Antibody


Western Blot: NTPCR Antibody [NBP1-88331] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HEK 293
Immunohistochemistry-Paraffin: NTPCR Antibody [NBP1-88331] - Staining of human adrenal gland shows distinct nuclear positivity in cortical cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

NTPCR Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRN
Specificity of human NTPCR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
NTPCR Lysate (NBP2-65735)
Control Peptide
NTPCR Protein (NBP1-88331PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NTPCR Antibody

  • C1orf57
  • chromosome 1 open reading frame 57
  • EC
  • FLJ11383
  • HCR-NTPase
  • human cancer-related NTPase
  • MGC13186
  • NTPase
  • Nucleoside triphosphate phosphohydrolase
  • nucleoside-triphosphatase C1orf57
  • nucleoside-triphosphatase, cancer-related
  • RP4-678E16.2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Rt
Applications: WB, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IP
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NTPCR Antibody (NBP1-88331) (0)

There are no publications for NTPCR Antibody (NBP1-88331).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NTPCR Antibody (NBP1-88331) (0)

There are no reviews for NTPCR Antibody (NBP1-88331). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NTPCR Antibody (NBP1-88331) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional NTPCR Products

Bioinformatics Tool for NTPCR Antibody (NBP1-88331)

Discover related pathways, diseases and genes to NTPCR Antibody (NBP1-88331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for NTPCR Antibody (NBP1-88331)

Find related products by research area.

Blogs on NTPCR

There are no specific blogs for NTPCR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NTPCR Antibody and receive a gift card or discount.


Gene Symbol NTPCR