DHX36 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DHX36 Antibody [NBP1-84286] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Staining of human placenta shows strong cytoplasmic positivity in decidual cells.

Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Analysis in human cell line EFO-21.

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DHX36 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DHX36 Antibody - BSA Free (NBP1-84286) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DHX36
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DHX36 Protein (NBP1-84286PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DHX36 Antibody - BSA Free

• DDX36
• DEAH (Asp-Glu-Ala-His) box polypeptide 36
• DEAH box protein 36
• EC 3.6.1
• EC 3.6.4.13
• G4 resolvase-1
• KIAA1488G4R1
• MLEL1RHAUDEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 36
• MLE-like protein 1
• probable ATP-dependent RNA helicase DHX36
• RNA helicase associated with AU-rich element ARE

Background

DHX36, also known as Probable ATP-dependent RNA helicase DHX36, consists of three isoforms of sizes 114.7 kDa, 113.2 kDa, and 111.5 kDa and is involved in breaking down mRNA with the ARE element in their 3'-UTR strand. Current research links this protein to sex development and spermatogenesis. The protein interacts with RPS9, AGO1, UBC, AGO2, and PHB in the RNA degradation pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DHX36