DHX32 Antibody

Images

 
Immunohistochemistry-Paraffin: DHX32 Antibody [NBP2-13921] Staining of human small intestine shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DHX32 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EKGDIVVFLACEQDIEKVCETVYQGSNLNPDLGELVVVPLYPKEKCSLFK PLDETEKRCQVYQRRVVLTTSSGEFLIWSNSVRFVIDVGVERR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHX32
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DHX32 Protein (NBP2-13921PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DHX32 Antibody

  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 32
  • DEAD/H box 32
  • DEAD/H helicase-like protein 1
  • DEAH (Asp-Glu-Ala-His) box polypeptide 32
  • DEAH box protein 32
  • DHLP1DDX32DEAD/H helicase-like protein-1
  • EC 3.6.1
  • EC 3.6.4.13
  • FLJ10694
  • FLJ10889
  • huDDX32
  • putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31319
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051428-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF1379
Species: Hu
Applications: WB, IHC
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92565
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-19777
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
MAB342
Species: Hu
Applications: WB, AgAct
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-57200
Species: Hu
Applications: ICC/IF
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-59448
Species: Hu
Applications: WB
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for DHX32 Antibody (NBP2-13921) (0)

There are no publications for DHX32 Antibody (NBP2-13921).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHX32 Antibody (NBP2-13921) (0)

There are no reviews for DHX32 Antibody (NBP2-13921). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DHX32 Antibody (NBP2-13921) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DHX32 Products

Bioinformatics Tool for DHX32 Antibody (NBP2-13921)

Discover related pathways, diseases and genes to DHX32 Antibody (NBP2-13921). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHX32 Antibody (NBP2-13921)

Discover more about diseases related to DHX32 Antibody (NBP2-13921).
 

Pathways for DHX32 Antibody (NBP2-13921)

View related products by pathway.

Blogs on DHX32

There are no specific blogs for DHX32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHX32 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX32