DHX32 Antibody - BSA Free

Immunohistochemistry-Paraffin: DHX32 Antibody [NBP2-13921] Staining of human small intestine shows moderate nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DHX32 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DHX32 Antibody - BSA Free (NBP2-13921) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EKGDIVVFLACEQDIEKVCETVYQGSNLNPDLGELVVVPLYPKEKCSLFKPLDETEKRCQVYQRRVVLTTSSGEFLIWSNSVRFVIDVGVERR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DHX32
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DHX32 Protein (NBP2-13921PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DHX32 Antibody - BSA Free

• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 32
• DEAD/H box 32
• DEAD/H helicase-like protein 1
• DEAH (Asp-Glu-Ala-His) box polypeptide 32
• DEAH box protein 32
• DHLP1DDX32DEAD/H helicase-like protein-1
• EC 3.6.1
• EC 3.6.4.13
• FLJ10694
• FLJ10889
• HuDDX32
• putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32

Background

DHX32, also known as Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32, consists of an 84.4 kDa and a 75.1 kDa isoform and is used in splicing and unwinding RNA in lymphoid tissue and other muscular tissues. The protein is being studied for its involvement in leukemia, brain cancer, and colorectal cancer. As a part of the mRNA processing and ATP binding pathways, the protein interacts with UBC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DHX32