UROS Antibody - BSA Free

Western Blot: UROS Antibody [NBP1-92565] - Analysis in control (vector only transfected HEK293T lysate) and UROS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: UROS Antibody [NBP1-92565] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: UROS Antibody [NBP1-92565] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Analysis in control (vector only transfected HEK293T lysate) and UROS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UROS Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NLKREILPKALKDKGIAMESITVYQTVAHPGIQGNLNSYYSQQGVPASITFFSPSGLTYSLKHIQELSGDNIDQIKFAAIGPTT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UROS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  UROS Protein (NBP1-92565PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for UROS Antibody - BSA Free

• EC 4.2.1.75
• Hydroxymethylbilane hydrolyase [cyclizing]
• hydroxymethylbilane hydrolyase
• UROIIIS
• uroporphyrinogen III synthase
• Uroporphyrinogen-III cosynthase
• uroporphyrinogen-III synthase

Background

UROS is encoded by this gene catalyzes the fourth step of porphyrin biosynthesis in the heme biosynthetic pathway. Defects in this gene cause congenital erythropoietic porphyria (Gunther's disease).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UROS