alcohol dehydrogenase 7 Antibody

Images

 
Western Blot: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunocytochemistry/ Immunofluorescence: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining of human stomach, lower shows strong cytoplasmic and nuclear positivity in glandular cells.
Western Blot: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alcohol dehydrogenase 7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADH7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
alcohol dehydrogenase 7 Protein (NBP1-90232PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for alcohol dehydrogenase 7 Antibody

  • ADH4
  • ADH-4
  • alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
  • alcohol dehydrogenase class 4 mu/sigma chain
  • Alcohol dehydrogenase class IV mu/sigma chain
  • alcohol dehydrogenase VII
  • alcohol dehydrogenase-7
  • class IV sigma-1 alcohol dehydrogenase
  • class IV sigmasigma alcohol dehydrogenase
  • EC 1.1.1
  • EC 1.1.1.1
  • Gastric alcohol dehydrogenase
  • Retinol dehydrogenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-45335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-30636
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37397
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
NBP2-30446
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52047
Species: Hu, Mu
Applications: WB, IHC, PEP-ELISA
H00000130-M01
Species: Hu
Applications: WB, ELISA
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-87158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-55418
Species: Hu
Applications: ICC/IF
H00145226-D01P
Species: Hu
Applications: WB, ELISA
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for alcohol dehydrogenase 7 Antibody (NBP1-90232) (0)

There are no publications for alcohol dehydrogenase 7 Antibody (NBP1-90232).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alcohol dehydrogenase 7 Antibody (NBP1-90232) (0)

There are no reviews for alcohol dehydrogenase 7 Antibody (NBP1-90232). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for alcohol dehydrogenase 7 Antibody (NBP1-90232) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alcohol dehydrogenase 7 Products

Bioinformatics Tool for alcohol dehydrogenase 7 Antibody (NBP1-90232)

Discover related pathways, diseases and genes to alcohol dehydrogenase 7 Antibody (NBP1-90232). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alcohol dehydrogenase 7 Antibody (NBP1-90232)

Discover more about diseases related to alcohol dehydrogenase 7 Antibody (NBP1-90232).
 

Pathways for alcohol dehydrogenase 7 Antibody (NBP1-90232)

View related products by pathway.

PTMs for alcohol dehydrogenase 7 Antibody (NBP1-90232)

Learn more about PTMs related to alcohol dehydrogenase 7 Antibody (NBP1-90232).

Blogs on alcohol dehydrogenase 7

There are no specific blogs for alcohol dehydrogenase 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alcohol dehydrogenase 7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADH7