alcohol dehydrogenase 7 Antibody


Western Blot: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunocytochemistry/ Immunofluorescence: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining in human esophagus and pancreas tissues using anti-ADH7 antibody. Corresponding ADH7 RNA-seq data are presented for the same more
Western Blot: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma more
Immunohistochemistry-Paraffin: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining of human stomach, lower shows strong cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining of human esophagus shows high expression.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

alcohol dehydrogenase 7 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV
Specificity of human, mouse, rat alcohol dehydrogenase 7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
alcohol dehydrogenase 7 Protein (NBP1-90232PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for alcohol dehydrogenase 7 Antibody

  • ADH4
  • ADH-4
  • alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
  • alcohol dehydrogenase class 4 mu/sigma chain
  • Alcohol dehydrogenase class IV mu/sigma chain
  • alcohol dehydrogenase VII
  • alcohol dehydrogenase-7
  • class IV sigma-1 alcohol dehydrogenase
  • class IV sigmasigma alcohol dehydrogenase
  • EC 1.1.1
  • EC
  • Gastric alcohol dehydrogenase
  • Retinol dehydrogenase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for alcohol dehydrogenase 7 Antibody (NBP1-90232) (0)

There are no publications for alcohol dehydrogenase 7 Antibody (NBP1-90232).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alcohol dehydrogenase 7 Antibody (NBP1-90232) (0)

There are no reviews for alcohol dehydrogenase 7 Antibody (NBP1-90232). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for alcohol dehydrogenase 7 Antibody (NBP1-90232) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional alcohol dehydrogenase 7 Products

Bioinformatics Tool for alcohol dehydrogenase 7 Antibody (NBP1-90232)

Discover related pathways, diseases and genes to alcohol dehydrogenase 7 Antibody (NBP1-90232). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alcohol dehydrogenase 7 Antibody (NBP1-90232)

Discover more about diseases related to alcohol dehydrogenase 7 Antibody (NBP1-90232).

Pathways for alcohol dehydrogenase 7 Antibody (NBP1-90232)

View related products by pathway.

PTMs for alcohol dehydrogenase 7 Antibody (NBP1-90232)

Learn more about PTMs related to alcohol dehydrogenase 7 Antibody (NBP1-90232).

Blogs on alcohol dehydrogenase 7

There are no specific blogs for alcohol dehydrogenase 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our alcohol dehydrogenase 7 Antibody and receive a gift card or discount.


Gene Symbol ADH7