HSD17B6 Antibody

Immunohistochemistry-Paraffin: HSD17B6 Antibody [NBP2-32431] - Staining in human liver and pancreas tissues using anti-HSD17B6 antibody. Corresponding HSD17B6 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: HSD17B6 Antibody [NBP2-32431] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: HSD17B6 Antibody [NBP2-32431] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: HSD17B6 Antibody [NBP2-32431] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

HSD17B6 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSD17B6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HSD17B6 Protein (NBP2-32431PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HSD17B6 Antibody

• 17-beta-HSD 6
• 17-beta-HSD6
• 17-beta-hydroxysteroid dehydrogenase type 6
• 3(alpha->beta)-hydroxysteroid epimerase
• 3-alpha->beta-HSE
• EC 1.1.1
• EC 1.1.1.105
• EC 1.1.1.62
• EC 1.1.1.63
• HSE3-hydroxysteroid epimerase
• hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)
• hydroxysteroid (17-beta) dehydrogenase 6
• NAD+ -dependent 3 alpha-hydroxysteroid dehydrogenase 3-hydroxysteroid epimerase
• Oxidative 3-alpha hydroxysteroid dehydrogenase
• oxidative 3-alpha-hydroxysteroid-dehydrogenase
• oxidoreductase
• retinol dehydrogenase
• RODH3(alpha->beta)-hydroxysteroid epimerasel
• SDR9C6
• short chain dehydrogenase/reductase family 9C, member 6,3-alpha->beta-hydroxysteroid epimerase

Background

HSD17B6 is encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HSD17B6 Antibody (NBP2-32431)(1)

Publication using NBP2-32431

• Hooks KB, Audoux J, Fazli H et al. New insights into diagnosis and therapeutic options for proliferative hepatoblastoma Hepatology. 2017-11-20 [PMID: 29152775] (IHC-P, Human)

Bioinformatics

• Gene Symbol: HSD17B6