HSD17B6 Antibody

Images

 
Immunohistochemistry-Paraffin: HSD17B6 Antibody [NBP2-32431] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSD17B6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSD17B6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HSD17B6 Protein (NBP2-32431PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSD17B6 Antibody

  • 17-beta-HSD 6
  • 17-beta-HSD6
  • 17-beta-hydroxysteroid dehydrogenase type 6
  • 3(alpha->beta)-hydroxysteroid epimerase
  • 3-alpha->beta-HSE
  • EC 1.1.1
  • EC 1.1.1.105
  • EC 1.1.1.62
  • EC 1.1.1.63
  • HSE3-hydroxysteroid epimerase
  • hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)
  • hydroxysteroid (17-beta) dehydrogenase 6
  • NAD+ -dependent 3 alpha-hydroxysteroid dehydrogenase 3-hydroxysteroid epimerase
  • Oxidative 3-alpha hydroxysteroid dehydrogenase
  • oxidative 3-alpha-hydroxysteroid-dehydrogenase
  • oxidoreductase
  • retinol dehydrogenase
  • RODH3(alpha->beta)-hydroxysteroid epimerasel
  • SDR9C6
  • short chain dehydrogenase/reductase family 9C, member 6,3-alpha->beta-hydroxysteroid epimerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97475
Species: Hu, Mu, Rt, Ge, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5227
Species: Hu, Mu
Applications: WB
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-32431
Species: Hu
Applications: IHC, IHC-P

Publications for HSD17B6 Antibody (NBP2-32431) (0)

There are no publications for HSD17B6 Antibody (NBP2-32431).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD17B6 Antibody (NBP2-32431) (0)

There are no reviews for HSD17B6 Antibody (NBP2-32431). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HSD17B6 Antibody (NBP2-32431) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSD17B6 Products

Bioinformatics Tool for HSD17B6 Antibody (NBP2-32431)

Discover related pathways, diseases and genes to HSD17B6 Antibody (NBP2-32431). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD17B6 Antibody (NBP2-32431)

Discover more about diseases related to HSD17B6 Antibody (NBP2-32431).
 

Pathways for HSD17B6 Antibody (NBP2-32431)

View related products by pathway.

Blogs on HSD17B6

There are no specific blogs for HSD17B6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSD17B6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B6