HSD17B6 Antibody


Immunohistochemistry-Paraffin: HSD17B6 Antibody [NBP2-32431] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: HSD17B6 Antibody [NBP2-32431] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: HSD17B6 Antibody [NBP2-32431] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HSD17B6 Antibody [NBP2-32431] - Staining in human liver and pancreas tissues using anti-HSD17B6 antibody. Corresponding HSD17B6 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: HSD17B6 Antibody [NBP2-32431] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HSD17B6 Antibody [NBP2-32431] - Staining in human liver and pancreas tissues.. Corresponding HSD17B6 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

HSD17B6 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLL
Specificity of human HSD17B6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HSD17B6 Protein (NBP2-32431PEP)
Read Publication using
NBP2-32431 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HSD17B6 Antibody

  • 17-beta-HSD 6
  • 17-beta-HSD6
  • 17-beta-hydroxysteroid dehydrogenase type 6
  • 3(alpha->beta)-hydroxysteroid epimerase
  • 3-alpha->beta-HSE
  • EC 1.1.1
  • EC
  • EC
  • EC
  • HSE3-hydroxysteroid epimerase
  • hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)
  • hydroxysteroid (17-beta) dehydrogenase 6
  • NAD+ -dependent 3 alpha-hydroxysteroid dehydrogenase 3-hydroxysteroid epimerase
  • Oxidative 3-alpha hydroxysteroid dehydrogenase
  • oxidative 3-alpha-hydroxysteroid-dehydrogenase
  • oxidoreductase
  • retinol dehydrogenase
  • RODH3(alpha->beta)-hydroxysteroid epimerasel
  • SDR9C6
  • short chain dehydrogenase/reductase family 9C, member 6,3-alpha->beta-hydroxysteroid epimerase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ma, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Pm, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for HSD17B6 Antibody (NBP2-32431)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for HSD17B6 Antibody (NBP2-32431) (0)

There are no reviews for HSD17B6 Antibody (NBP2-32431). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HSD17B6 Antibody (NBP2-32431) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional HSD17B6 Products

Bioinformatics Tool for HSD17B6 Antibody (NBP2-32431)

Discover related pathways, diseases and genes to HSD17B6 Antibody (NBP2-32431). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD17B6 Antibody (NBP2-32431)

Discover more about diseases related to HSD17B6 Antibody (NBP2-32431).

Pathways for HSD17B6 Antibody (NBP2-32431)

View related products by pathway.

Blogs on HSD17B6

There are no specific blogs for HSD17B6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HSD17B6 Antibody and receive a gift card or discount.


Gene Symbol HSD17B6