DFF45/ICAD Antibody

Images

 
Western Blot: DFF45/ICAD Antibody [NBP1-85247] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: DFF45/ICAD Antibody [NBP1-85247] - Staining of human urinary bladder shows nuclear and cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DFF45/ICAD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LRQSCAIVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DFFA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DFF45/ICAD Protein (NBP1-85247PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DFF45/ICAD Antibody

  • DFF1
  • DFF1DNA fragmentation factor 45 kDa subunit
  • DFF45
  • DFF45DNA fragmentation factor subunit alpha
  • DFF-45DNA fragmentation factor, 45 kD, alpha polypeptide
  • DFFA
  • DNA fragmentation factor, 45kDa, alpha polypeptide
  • ICAD
  • Inhibitor of CAD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13592
Species: Hu
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85247
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DFF45/ICAD Antibody (NBP1-85247) (0)

There are no publications for DFF45/ICAD Antibody (NBP1-85247).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DFF45/ICAD Antibody (NBP1-85247) (0)

There are no reviews for DFF45/ICAD Antibody (NBP1-85247). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DFF45/ICAD Antibody (NBP1-85247) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DFF45/ICAD Products

Bioinformatics Tool for DFF45/ICAD Antibody (NBP1-85247)

Discover related pathways, diseases and genes to DFF45/ICAD Antibody (NBP1-85247). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DFF45/ICAD Antibody (NBP1-85247)

Discover more about diseases related to DFF45/ICAD Antibody (NBP1-85247).
 

Pathways for DFF45/ICAD Antibody (NBP1-85247)

View related products by pathway.

PTMs for DFF45/ICAD Antibody (NBP1-85247)

Learn more about PTMs related to DFF45/ICAD Antibody (NBP1-85247).
 

Research Areas for DFF45/ICAD Antibody (NBP1-85247)

Find related products by research area.

Blogs on DFF45/ICAD

There are no specific blogs for DFF45/ICAD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DFF45/ICAD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DFFA
Entrez