TC21/R-Ras2 Antibody (2D3-4B8) - Azide and BSA Free

Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Analysis of RRAS2 expression in transfected 293T cell line by RRAS2 monoclonal antibody (M01), clone 2D3-4B8.Lane 1: RRAS2 transfected lysate (Predicted MW: 23.4 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Analysis of monoclonal antibody to RRAS2 on A-431 cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Analysis of monoclonal antibody to RRAS2 on formalin-fixed paraffin-embedded human dysgerminoma tissue. Antibody concentration 5 ug/ml.

Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Analysis of RRAS2 expression in HeLa.

Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Analysis of RRAS2 expression in PC-12.

Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Analysis of RRAS2 expression in Raw 264.7.

Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - RRAS2 monoclonal antibody (M01), clone 2D3-4B8 Analysis of RRAS2 expression in A-431.

Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Analysis of RRAS2 expression in NIH/3T3.

ELISA: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Detection limit for recombinant GST tagged RRAS2 is 1 ng/ml as a capture antibody.

Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Validation of R-Ras2 as the defatty-acylation target of SIRT6.(A) mRNA & protein levels of R-Ras2 in Sirt6 WT & KO MEFs. Image collected & cropped by CiteAb from the following publication (//elifesciences.org/articles/25158), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Identification of defatty-acylation targets of SIRT6 that contribute to its function in cell proliferation.(A) Cell proliferation of Sirt6 KO MEFs stably expressing pCDH empty vector, SIRT6 WT, G60A, or H133Y. Cell proliferation was assayed & quantified using crystal violet staining. Values with error bars indicate mean ± s.d. of three biological replicates. * indicates p<0.05 & ‘ns’ indicates no statistical significance when comparing to Sirt6 KO MEFs with pCDH. (B) Schematic overview of the SILAC experiment to identify SIRT6 lysine defatty-acylation targets. (C) Data analysis & filter of SILAC results. (D) Effects of R-Ras2 knockdown on the proliferation of Sirt6 WT & KO MEFs. Values with error bars indicate mean ± s.d. of three biological replicates. *** indicates p<0.005 for comparing to Sirt6 KO MEFs with ctrl shRNA.DOI://dx.doi.org/10.7554/eLife.25158.003Schematic overview of the SILAC experiment to compare the protein abundance in Sirt6 WT & KO MEFs.DOI://dx.doi.org/10.7554/eLife.25158.004 Image collected & cropped by CiteAb from the following publication (//elifesciences.org/articles/25158), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, KD
• Clone: 2D3-4B8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TC21/R-Ras2 Antibody (2D3-4B8) - Azide and BSA Free Summary

• Immunogen: RRAS2 (AAH13106, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
• Localization: Cell membrane; Lipid-anchor; Cytoplasmic side.
• Specificity: RRAS2 - related RAS viral (r-ras) oncogene homolog 2
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RRAS2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Knockdown Validated
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TC21/R-Ras2 Antibody (2D3-4B8) - Azide and BSA Free

• ras-related protein R-Ras2
• related RAS viral (r-ras) oncogene homolog 2
• RRAS2
• TC21
• TC21Ras-like protein TC21
• Teratocarcinoma oncogene

Background

RRAS2 (Related RAS viral oncogene homolog 2) is a member of the Ras superfamily. It is a GTP-binding protein with GTPase activity. It might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins. RRAS2 has high oncogenic potential and is mutated in some human tumors and overexpressed in breast cancer cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TC21/R-Ras2 Antibody (H00022800-M01)(5)

Publications using H00022800-M01

• Alejandro H, Clara O, Claudia C et al. Overexpression of wild type RRAS2, without oncogenic mutations, drives chronic lymphocytic leukemia. Mol Cancer. 2022-02-04 [PMID: 35120522]
• Sophia L, Jeremy W, Xi C et al. High-efficiency unassisted transfection of platelets with naked double-stranded miRNAs modulates signal-activated translation and platelet function. Platelets. 2020-08-25 [PMID: 32838617]
• Janapati S, Wurtzel J, Dangelmaier C et al. TC21/RRas2 regulates GPVI-FcR?-mediated platelet activation and thrombus stability. J Thromb Haemost 2018-06-08 [PMID: 29883056]
• Zhang X, Spiegelman NA, Nelson OD et al. SIRT6 regulates Ras-related protein R-Ras2 by lysine defatty-acylation eLife 2017-04-13 [PMID: 28406396]
• Patmore DM, Welch S, Fulkerson PC et al. In Vivo Regulation of TGF-b by R-Ras2 Revealed through Loss of the RasGAP Protein NF1. Cancer Res. 2012-08-23 [PMID: 22918885]

Bioinformatics

• Gene Symbol: RRAS2
• Entrez:
  • 22800(Human)
• OMIM:
  • 600098(Human)
• Uniprot:
  • AAH13106(Human)