Home » TC21/R-Ras2 » TC21 Antibodies » TC21/R-Ras2 Antibody (2D3-4B8)

TC21/R-Ras2 Antibody (2D3-4B8)

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Analysis of RRAS2 expression in transfected 293T cell line by RRAS2 monoclonal antibody (M01), clone 2D3-4B8.Lane 1: RRAS2 transfected lysate (Predicted MW: 23.4 KDa).Lane 2: Non-transfected lysate.
Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Analysis of RRAS2 expression in transfected 293T cell line by RRAS2 monoclonal antibody (M01), clone 2D3-4B8.Lane 1: RRAS2 transfected lysate (Predicted MW: ...read more
Immunocytochemistry/ Immunofluorescence: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Analysis of monoclonal antibody to RRAS2 on A-431 cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Analysis of monoclonal antibody to RRAS2 on formalin-fixed paraffin-embedded human dysgerminoma tissue. Antibody concentration 5 ug/ml.
Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Analysis of RRAS2 expression in HeLa.
Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Analysis of RRAS2 expression in PC-12.
Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Analysis of RRAS2 expression in Raw 264.7.
Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - RRAS2 monoclonal antibody (M01), clone 2D3-4B8 Analysis of RRAS2 expression in A-431.
Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Analysis of RRAS2 expression in NIH/3T3.
ELISA: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Detection limit for recombinant GST tagged RRAS2 is 1 ng/ml as a capture antibody.
Genetic Strategies: Knockdown Validated: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Identification of defatty-acylation targets of SIRT6 that contribute to its function in cell proliferation. Effects of ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, KD
Clone
2D3-4B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

TC21/R-Ras2 Antibody (2D3-4B8) Summary

Immunogen
RRAS2 (AAH13106, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Localization
Cell membrane; Lipid-anchor; Cytoplasmic side.
Specificity
RRAS2 - related RAS viral (r-ras) oncogene homolog 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RRAS2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using H00022800-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TC21/R-Ras2 Antibody (2D3-4B8)

  • ras-related protein R-Ras2
  • related RAS viral (r-ras) oncogene homolog 2
  • RRAS2
  • TC21
  • TC21Ras-like protein TC21
  • Teratocarcinoma oncogene

Background

RRAS2 (Related RAS viral oncogene homolog 2) is a member of the Ras superfamily. It is a GTP-binding protein with GTPase activity. It might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins. RRAS2 has high oncogenic potential and is mutated in some human tumors and overexpressed in breast cancer cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(26 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
HRAS Antibody
NBP2-42864
Western Blot: HRAS Antibody [NBP2-42864] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HRAS antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: HRAS Antibody [NBP2-42864] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with H-RAS antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: HRAS Antibody [NBP2-42864] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with H-Ras antibody diluted at 1:5000.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Raf-1 Antibody
(563002)
MAB4540
Western blot shows lysates of MCF‑7 human breast cancer cell line, HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, L‑929 mouse fibroblast cell line, and NRK rat normal kidney cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Raf‑1 at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Raf‑1 was detected in immersion fixed paraffin-embedded sections of human liver array using Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, WB
M-Ras/R-Ras3
Antibody
AF3606
Western blot shows lysates of L6 rat myoblast cell line. PVDF membrane was probed with 2 µg/mL Goat Anti-Human/Rat M‑Ras/R‑Ras3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3606) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). For additional reference, recombinant human R‑Ras, TC21/R-Ras2, and M‑Ras/R‑Ras3 (2 ng/lane) were included. A specific band for M‑Ras/R‑Ras3 was detected at approximately 24 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Rt
Applications: WB
Dexras1 Antibody
NBP1-91830
Western Blot: Dexras1 Antibody [NBP1-91830] - Analysis in control (vector only transfected HEK293T lysate) and RASD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830] - Staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RASGRF1 Antibody
NBP1-85727
Immunohistochemistry-Paraffin: RASGRF1 Antibody [NBP1-85727] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: RASGRF1 Antibody [NBP1-85727] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & the Golgi apparatus. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
RALGDS Antibody
NBP2-93790
Immunocytochemistry/Immunofluorescence: RALGDS Antibody [NBP2-93790] - Analysis of L929 cells using RALGDS at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: RALGDS Antibody [NBP2-93790] - Analysis of U-2 OS cells using RALGDS at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: RALGDS Antibody [NBP2-93790] - Paraffin-embedded human thyroid cancer using RALGDS .
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p110
delta Antibody (OTI1D ...
NBP2-46404
Immunohistochemistry: PI 3-Kinase p110 delta Antibody (1D11) [NBP2-46404] - Analysis of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: PI 3-Kinase p110 delta Antibody (1D11) [NBP2-46404] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: PI 3-Kinase p110 delta Antibody (1D11) [NBP2-46404] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
RRAS Antibody
NB100-56161
Immunohistochemistry-Paraffin: RRAS Antibody - Unpurified [NB100-56161] - RRAS was detected in immersion fixed paraffin-embedded sections of human placenta using this antibody at 1:500 for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm and plasma membrane in decidual and trophoblast cells.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Neurofibromin 1
Antibody
NB300-155
Immunohistochemistry: Neurofibromin 1 Antibody [NB300-155] - NF1 protein labeling displays positive signal in the maturing and the hypertrophic cartilages but only faint labeling in the proliferative cartilage.
Western Blot: Neurofibromin 1 Antibody [NB300-155] - Western Blot of (A, B, C above).
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
ZHX2 Antibody
NBP1-82956
Immunocytochemistry/Immunofluorescence: ZHX2 Antibody [NBP1-82956] - Staining of human cell line REH shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ZHX2 Antibody [NBP1-82956] - Staining of human cerebral cortex, kidney, liver and lymph node using Anti-ZHX2 antibody NBP1-82956 (A) shows similar protein distribution across tissues to independent antibody NBP1-82955 (B).
Immunohistochemistry-Paraffin: ZHX2 Antibody [NBP1-82956] - Staining of human lymph node.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NRAS Antibody
(6S6F3)
NBP3-16473
Immunocytochemistry/Immunofluorescence: NRAS Antibody (6S6F3) [NBP3-16473] - Immunofluorescence analysis of U-2 OS cells using NRAS Rabbit mAb (NBP3-16473) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: NRAS Antibody (6S6F3) [NBP3-16473] - Western blot analysis of extracts of various cell lines, using NRAS Rabbit mAb (NBP3-16473) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: NRAS Antibody (6S6F3) [NBP3-16473] - Western blot analysis of extracts of Rat lung, using NRAS Rabbit mAb (NBP3-16473) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Rasgrp1 Antibody
NBP1-98413
Western Blot: Rasgrp1 Antibody [NBP1-98413] - Host: Rabbit. Target Name: RASGRP1. Sample Tissue: Human HCT116 Whole Cell. Antibody Dilution: 3ug/ml
Western Blot: Rasgrp1 Antibody [NBP1-98413] - Jurkat Cell Lysate 1.0ug/ml, Gel Concentration: 6-18%
Species: Hu
Applications: WB
RalA/RalB Antibody
AF3204
Western blot shows lysates of U937 human histiocytic lymphoma cell line and NIH-3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL Goat Anti-Human/Mouse/Rat RalA/RalB Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3204) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). For additional reference, recombinant human RalA and RalB (5 ng/lane) were included. A specific band for RalA/RalB was detected at approximately 25 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
SOS1 Antibody
(SOS-01) - BSA Free
NB110-68800
Western Blot: SOS1 Antibody (SOS-01) [NB110-68800] - Analysis (reducing conditions) of human Sos using anti-human Sos (SOS-1). Lane 1: K562 human Caucasian chronic myeloid leukemia cell line Lane 2: RAJI human Burkitt lymphoma cell line
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in human primary fibroblasts using anti-Sos (SOS-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in murine transformed fibroblasts using anti-Sos (SOS-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Species: Hu, Mu
Applications: ICC/IF, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows 25 ng of Recombinant Human EphB2 Fc Chimera (Catalog # 5189-B2) and Recombinant Mouse EphB2 Fc Chimera (Catalog # 467-B2). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for EphB2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
EphB2 was detected in immersion fixed MBA‑MB‑468 human breast cancer cell line using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(36 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB

Publications for TC21/R-Ras2 Antibody (H00022800-M01)(2)


Reviews for TC21/R-Ras2 Antibody (H00022800-M01) (0)

There are no reviews for TC21/R-Ras2 Antibody (H00022800-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TC21/R-Ras2 Antibody (H00022800-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TC21/R-Ras2 Products

Bioinformatics Tool for TC21/R-Ras2 Antibody (H00022800-M01)

Discover related pathways, diseases and genes to TC21/R-Ras2 Antibody (H00022800-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TC21/R-Ras2 Antibody (H00022800-M01)

Discover more about diseases related to TC21/R-Ras2 Antibody (H00022800-M01).
 

Pathways for TC21/R-Ras2 Antibody (H00022800-M01)

View related products by pathway.

PTMs for TC21/R-Ras2 Antibody (H00022800-M01)

Learn more about PTMs related to TC21/R-Ras2 Antibody (H00022800-M01).
 

Research Areas for TC21/R-Ras2 Antibody (H00022800-M01)

Find related products by research area.

Blogs on TC21/R-Ras2

There are no specific blogs for TC21/R-Ras2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TC21/R-Ras2 Antibody (2D3-4B8) and receive a gift card or discount.


Bioinformatics

Gene Symbol RRAS2
Entrez
OMIM
Uniprot