TC21/R-Ras2 Antibody (2D3-4B8)

Images

 
Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Analysis of RRAS2 expression in transfected 293T cell line by RRAS2 monoclonal antibody (M01), clone 2D3-4B8.Lane 1: RRAS2 transfected lysate (Predicted MW: ...read more
Immunocytochemistry/ Immunofluorescence: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Analysis of monoclonal antibody to RRAS2 on A-431 cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Analysis of monoclonal antibody to RRAS2 on formalin-fixed paraffin-embedded human dysgerminoma tissue. Antibody concentration 5 ug/ml.
Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Analysis of RRAS2 expression in HeLa.
Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Analysis of RRAS2 expression in PC-12.
Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Analysis of RRAS2 expression in Raw 264.7.
Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - RRAS2 monoclonal antibody (M01), clone 2D3-4B8 Analysis of RRAS2 expression in A-431.
Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Analysis of RRAS2 expression in NIH/3T3.
ELISA: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Detection limit for recombinant GST tagged RRAS2 is 1 ng/ml as a capture antibody.
Genetic Strategies: Knockdown Validated: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Identification of defatty-acylation targets of SIRT6 that contribute to its function in cell proliferation. Effects of ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, KD
Clone
2D3-4B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

TC21/R-Ras2 Antibody (2D3-4B8) Summary

Immunogen
RRAS2 (AAH13106, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Localization
Cell membrane; Lipid-anchor; Cytoplasmic side.
Specificity
RRAS2 - related RAS viral (r-ras) oncogene homolog 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RRAS2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using H00022800-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TC21/R-Ras2 Antibody (2D3-4B8)

  • ras-related protein R-Ras2
  • related RAS viral (r-ras) oncogene homolog 2
  • RRAS2
  • TC21
  • TC21Ras-like protein TC21
  • Teratocarcinoma oncogene

Background

RRAS2 (Related RAS viral oncogene homolog 2) is a member of the Ras superfamily. It is a GTP-binding protein with GTPase activity. It might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins. RRAS2 has high oncogenic potential and is mutated in some human tumors and overexpressed in breast cancer cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, WB
AF3606
Species: Hu, Rt
Applications: WB
NBP1-91830
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-93790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NB100-56161
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB300-155
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-82956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP3-16473
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-98413
Species: Hu
Applications: WB
AF3204
Species: Hu, Mu, Rt
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB

Publications for TC21/R-Ras2 Antibody (H00022800-M01)(2)

Reviews for TC21/R-Ras2 Antibody (H00022800-M01) (0)

There are no reviews for TC21/R-Ras2 Antibody (H00022800-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TC21/R-Ras2 Antibody (H00022800-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TC21/R-Ras2 Products

Bioinformatics Tool for TC21/R-Ras2 Antibody (H00022800-M01)

Discover related pathways, diseases and genes to TC21/R-Ras2 Antibody (H00022800-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TC21/R-Ras2 Antibody (H00022800-M01)

Discover more about diseases related to TC21/R-Ras2 Antibody (H00022800-M01).
 

Pathways for TC21/R-Ras2 Antibody (H00022800-M01)

View related products by pathway.

PTMs for TC21/R-Ras2 Antibody (H00022800-M01)

Learn more about PTMs related to TC21/R-Ras2 Antibody (H00022800-M01).
 

Research Areas for TC21/R-Ras2 Antibody (H00022800-M01)

Find related products by research area.

Blogs on TC21/R-Ras2

There are no specific blogs for TC21/R-Ras2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TC21/R-Ras2 Antibody (2D3-4B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol RRAS2
Entrez
OMIM
Uniprot