TC21/R-Ras2 Antibody (2D3-4B8) - Azide and BSA Free Summary
| Immunogen |
RRAS2 (AAH13106, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF |
| Localization |
Cell membrane; Lipid-anchor; Cytoplasmic side. |
| Specificity |
RRAS2 - related RAS viral (r-ras) oncogene homolog 2 |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
RRAS2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Immunocytochemistry/ Immunofluorescence 1:10-1:500
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
- Knockdown Validated
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TC21/R-Ras2 Antibody (2D3-4B8) - Azide and BSA Free
Background
RRAS2 (Related RAS viral oncogene homolog 2) is a member of the Ras superfamily. It is a GTP-binding protein with GTPase activity. It might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins. RRAS2 has high oncogenic potential and is mutated in some human tumors and overexpressed in breast cancer cell lines.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Publications for TC21/R-Ras2 Antibody (H00022800-M01)(5)
Showing Publications 1 -
5 of 5.
| Publications using H00022800-M01 |
Applications |
Species |
| Alejandro H, Clara O, Claudia C et al. Overexpression of wild type RRAS2, without oncogenic mutations, drives chronic lymphocytic leukemia. Mol Cancer. 2022-02-04 [PMID: 35120522] |
|
|
| Sophia L, Jeremy W, Xi C et al. High-efficiency unassisted transfection of platelets with naked double-stranded miRNAs modulates signal-activated translation and platelet function. Platelets. 2020-08-25 [PMID: 32838617] |
|
|
| Janapati S, Wurtzel J, Dangelmaier C et al. TC21/RRas2 regulates GPVI-FcR?-mediated platelet activation and thrombus stability. J Thromb Haemost 2018-06-08 [PMID: 29883056] |
|
|
| Zhang X, Spiegelman NA, Nelson OD et al. SIRT6 regulates Ras-related protein R-Ras2 by lysine defatty-acylation eLife 2017-04-13 [PMID: 28406396] |
|
|
| Patmore DM, Welch S, Fulkerson PC et al. In Vivo Regulation of TGF-b by R-Ras2 Revealed through Loss of the RasGAP Protein NF1. Cancer Res. 2012-08-23 [PMID: 22918885] |
|
|
Reviews for TC21/R-Ras2 Antibody (H00022800-M01) (0)
There are no reviews for TC21/R-Ras2 Antibody (H00022800-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TC21/R-Ras2 Antibody (H00022800-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TC21/R-Ras2 Products
Research Areas for TC21/R-Ras2 Antibody (H00022800-M01)
Find related products by research area.
|
Blogs on TC21/R-Ras2