RASD2 Antibody

Images

 
Western Blot: RASD2 Antibody [NBP1-82775] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: RASD2 Antibody [NBP1-82775] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RASD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RASD2 Protein (NBP1-82775PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-82775 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RASD2 Antibody

  • GTP-binding protein Rhes
  • MGC:4834
  • RASD family, member 2
  • Rhes
  • TEM2Ras homolog enriched in striatum
  • Tumor endothelial marker 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-29617
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP2-02004
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-33534
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RASD2 Antibody (NBP1-82775) (0)

There are no publications for RASD2 Antibody (NBP1-82775).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for RASD2 Antibody (NBP1-82775) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat and Mouse.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-82775:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Rat and Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot RASD2 NBP1-82775
Enlarge
reviewed by:
Anonymous
WB Rat and Mouse 05/03/2017
View

Summary

ApplicationWestern Blot
Sample TestedPC12 cell whole lysate, Sample Amount: 25ug,Mouse Neuro2A whole cell lysate
SpeciesRat and Mouse

Comments

CommentsAnother company's RASD2 antibody displayed numerous 'zebra stripes', we stripped and reprobed this membrane with this Novus antibody and were able to detect endogenous RASD2 in the PC12 cells, and not in the N2A cells as they don't express RASD2.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RASD2 Antibody (NBP1-82775) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RASD2 Products

Bioinformatics Tool for RASD2 Antibody (NBP1-82775)

Discover related pathways, diseases and genes to RASD2 Antibody (NBP1-82775). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASD2 Antibody (NBP1-82775)

Discover more about diseases related to RASD2 Antibody (NBP1-82775).
 

Pathways for RASD2 Antibody (NBP1-82775)

View related products by pathway.

PTMs for RASD2 Antibody (NBP1-82775)

Learn more about PTMs related to RASD2 Antibody (NBP1-82775).
 

Research Areas for RASD2 Antibody (NBP1-82775)

Find related products by research area.

Blogs on RASD2

There are no specific blogs for RASD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
05/03/2017
Application: WB
Species: Rat and Mouse

Bioinformatics

Gene Symbol RASD2