Desmocollin-3 Antibody


Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human esophagus shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining in human esophagus and kidney tissues using anti-DSC3 antibody. Corresponding DSC3 RNA-seq data are presented more

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Desmocollin-3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VTDSNDNAPTFRQNAYEAFVEENAFNVEILRIPIEDKDLINT
Specificity of human Desmocollin-3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Read Publication using
NBP2-31886 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26380766).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Desmocollin-3 Antibody

  • Cadherin family member 3
  • CDHF3
  • desmocollin 3
  • Desmocollin3
  • Desmocollin-3
  • desmocollin-4
  • DSC
  • DSC1
  • DSC2
  • DSC3
  • DSC4
  • DSC4desmocollin-3
  • HT-CP


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, DB, ICC/IF, IHC, IHC-P, IP, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Species: Hu
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Desmocollin-3 Antibody (NBP2-31886)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Desmocollin-3 Antibody (NBP2-31886) (0)

There are no reviews for Desmocollin-3 Antibody (NBP2-31886). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Desmocollin-3 Antibody (NBP2-31886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Desmocollin-3 Products

Bioinformatics Tool for Desmocollin-3 Antibody (NBP2-31886)

Discover related pathways, diseases and genes to Desmocollin-3 Antibody (NBP2-31886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Desmocollin-3 Antibody (NBP2-31886)

Discover more about diseases related to Desmocollin-3 Antibody (NBP2-31886).

Pathways for Desmocollin-3 Antibody (NBP2-31886)

View related products by pathway.

PTMs for Desmocollin-3 Antibody (NBP2-31886)

Learn more about PTMs related to Desmocollin-3 Antibody (NBP2-31886).

Blogs on Desmocollin-3

There are no specific blogs for Desmocollin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Desmocollin-3 Antibody and receive a gift card or discount.


Gene Symbol DSC3