Desmocollin-3 Antibody

Images

 
Immunohistochemistry: Desmocollin 3 Antibody [NBP2-31886] - Staining of human esophagus shows strong membranous positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Desmocollin-3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VTDSNDNAPTFRQNAYEAFVEENAFNVEILRIPIEDKDLINT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DSC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Desmocollin-3 Protein (NBP2-31886PEP)
Publications
Read Publication using
NBP2-31886 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26380766).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Desmocollin-3 Antibody

  • Cadherin family member 3
  • CDHF3
  • CDHF3HT-CP
  • desmocollin 3
  • Desmocollin3
  • Desmocollin-3
  • desmocollin-4
  • DSC
  • DSC1
  • DSC2
  • DSC3
  • DSC4
  • DSC4desmocollin-3
  • HT-CP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
MAB944
Species: Hu
Applications: WB, IHC
NBP1-78984
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF947
Species: Hu
Applications: WB, Simple Western
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NB100-56146
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-43312
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
NBL1-16214
Species: Hu
NBP2-12553
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Desmocollin-3 Antibody (NBP2-31886)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Desmocollin-3 Antibody (NBP2-31886) (0)

There are no reviews for Desmocollin-3 Antibody (NBP2-31886). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Desmocollin-3 Antibody (NBP2-31886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Desmocollin-3 Products

Bioinformatics Tool for Desmocollin-3 Antibody (NBP2-31886)

Discover related pathways, diseases and genes to Desmocollin-3 Antibody (NBP2-31886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Desmocollin-3 Antibody (NBP2-31886)

Discover more about diseases related to Desmocollin-3 Antibody (NBP2-31886).
 

Pathways for Desmocollin-3 Antibody (NBP2-31886)

View related products by pathway.

PTMs for Desmocollin-3 Antibody (NBP2-31886)

Learn more about PTMs related to Desmocollin-3 Antibody (NBP2-31886).

Blogs on Desmocollin-3

There are no specific blogs for Desmocollin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Desmocollin-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DSC3
Entrez
Uniprot