Desmocollin-3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Analysis in human skin and liver tissues using NBP2-31886 antibody. Corresponding Desmocollin-3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human liver shows no membranous postivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human esophagus shows high expression.

Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human tonsil shows moderate membranous positivity in squamous epithelial cells and non-germinal center cells.

Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human placenta shows moderate membranous postivity in trophoblastic cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Desmocollin-3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Desmocollin-3 Antibody - BSA Free (NBP2-31886) is a polyclonal antibody validated for use in IHC. Anti-Desmocollin-3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VTDSNDNAPTFRQNAYEAFVEENAFNVEILRIPIEDKDLINT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DSC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Desmocollin-3 Protein (NBP2-31886PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Desmocollin-3 Antibody - BSA Free

• Cadherin family member 3
• CDHF3
• CDHF3HT-CP
• desmocollin 3
• Desmocollin3
• Desmocollin-3
• Desmocollin-4
• DSC
• DSC1
• DSC2
• DSC3
• DSC4
• DSC4desmocollin-3
• HT-CP

Background

Desmocollin 3 is encoded by this gene is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation. The desmosomal family members are arranged in two clusters on chromosome 18, occupying less than 650 kb combined. Alternative splicing results in two transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Desmocollin-3 Antibody (NBP2-31886)(1)

Publication using NBP2-31886

• Zhan C, Yan L, Wang L et al. Identification of immunohistochemical markers for distinguishing lung adenocarcinoma from squamous cell carcinoma. J Thorac Dis 2015-08-01 [PMID: 26380766] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: DSC3
• Uniprot:
  • Q14574()