Desmocollin-1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Desmocollin-1 Antibody - BSA Free (NBP2-62695) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: RQVILQVGVINEAQFSKAASSQTPTMCTTTVTVKIIDSDEGPECHPPVKVIQSQDGFPAGQELLGYKALDPEISSGEGLRYQKLGDEDNWFEINQHTG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DSC1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Desmocollin-1 Antibody - BSA Free
Background
The protein encoded by the Desmosomal Protein gene is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation. The desmosomal family members are arranged in two clusters on chromosome 18, occupying less than 650 kb combined. Alternative splicing results in two transcript variants encoding distinct isoforms. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: IHC
Species: Hu, Mu
Applications: DB, ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Publications for Desmocollin-1 Antibody (NBP2-62695) (0)
There are no publications for Desmocollin-1 Antibody (NBP2-62695).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Desmocollin-1 Antibody (NBP2-62695) (0)
There are no reviews for Desmocollin-1 Antibody (NBP2-62695).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Desmocollin-1 Antibody (NBP2-62695) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Desmocollin-1 Products
Blogs on Desmocollin-1