Plakophilin 1 Antibody

Images

 
Western Blot: Plakophilin 1 Antibody [NBP1-90042] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Plakophilin 1 Antibody [NBP1-90042] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry-Paraffin: Plakophilin 1 Antibody [NBP1-90042] - Staining of human oral mucosa shows strong cytoplasmic, membranous and nuclear positivity in squamous epithelial cells.
Western Blot: Plakophilin 1 Antibody [NBP1-90042] - Analysis in human cell line PC-3.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Plakophilin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YTVRNLMASQPQLAKQYFSSSMLNNIINLCRSSASPKAAEAARLLLSDMWSSKELQGVLRQQGFDRNMLGTLAGANSLRNFTSRF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PKP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Plakophilin 1 Protein (NBP1-90042PEP)
Publications
Read Publication using NBP1-90042.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22170739). Mouse (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Plakophilin 1 Antibody

  • B6PBand 6 protein
  • MGC138829
  • plakophilin 1 (ectodermal dysplasia/skin fragility syndrome)
  • plakophilin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49379
Species: Hu
Applications: ICC/IF, IHC
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB944
Species: Hu
Applications: WB, IHC
NBP1-91612
Species: Mu
Applications: WB
H00008502-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-59109
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-78984
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB7265
Species: Mu
Applications: WB, IHC
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4870
Species: Hu
Applications: WB, ICC
AF947
Species: Hu
Applications: WB, Simple Western

Publications for Plakophilin 1 Antibody (NBP1-90042)(1)

Reviews for Plakophilin 1 Antibody (NBP1-90042) (0)

There are no reviews for Plakophilin 1 Antibody (NBP1-90042). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Plakophilin 1 Antibody (NBP1-90042) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Plakophilin 1 Products

Bioinformatics Tool for Plakophilin 1 Antibody (NBP1-90042)

Discover related pathways, diseases and genes to Plakophilin 1 Antibody (NBP1-90042). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plakophilin 1 Antibody (NBP1-90042)

Discover more about diseases related to Plakophilin 1 Antibody (NBP1-90042).
 

Pathways for Plakophilin 1 Antibody (NBP1-90042)

View related products by pathway.

PTMs for Plakophilin 1 Antibody (NBP1-90042)

Learn more about PTMs related to Plakophilin 1 Antibody (NBP1-90042).
 

Research Areas for Plakophilin 1 Antibody (NBP1-90042)

Find related products by research area.

Blogs on Plakophilin 1

There are no specific blogs for Plakophilin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Plakophilin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PKP1