DENND1B Antibody - BSA Free

Western Blot: DENND1B Antibody [NBP1-62205] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DENND1B Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to DENND1B(DENN/MADD domain containing 1B) The peptide sequence was selected form the middle region of DENND1B. Peptide sequence PVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DENND1B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DENND1B Antibody - BSA Free

• C1ORF18
• C1orf218
• chromosome 1 open reading frame 218
• Connecdenn 2
• DENN domain-containing protein 1B
• DENN/MADD domain containing 1B
• DKFZp547O0715
• FAM31BMGC103810
• FLJ20054
• FLJ21179
• FLJ33888
• member B
• Protein FAM31B

Background

DENND1B contains 1 dDENN domain, 1 DENN domain and 1 uDENN domain. The function of the DENND1B protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DENND1B
• OMIM:
  • NP_659414(Human)
• Uniprot:
  • Q6P3S1(Human)