DEDD Antibody - BSA Free

Staining of human cell line MCF-7 shows localization to nucleoplasm & nucleoli.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DEDD Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein DEDD using the following amino acid sequence: PEPRPPQPSKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDI
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DEDD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DEDD Antibody - BSA Free

• CASP8IP1
• death effector domain containing
• death effector domain-containing protein
• Death effector domain-containing testicular molecule
• death effector domain-containing
• DEDD1
• DEDPRO1
• DEFTKE05
• FLDED1
• FLDED-1

Background

DEDD, also known as Death effector domain-containing protein, consists of a 36.8 kDa and a 40.4 kDa isoform and is involved in regulating the degradation of CASP3 in certain substances during apoptosis. Current research is exploring the effect of the protein on diseases such as dental fluorosis and dental caries. The protein is involved in transcription pathways with APLP2, CASP8, DEDD2, SMAD3, and CASP10.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DEDD