DEDD Antibody - BSA Free

Immunohistochemistry: DEDD Antibody [NBP2-68959] - Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DEDD Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSD
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DEDD
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  DEDD Recombinant Protein Antigen (NBP2-68959PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for DEDD Antibody - BSA Free

• CASP8IP1
• death effector domain containing
• death effector domain-containing protein
• Death effector domain-containing testicular molecule
• death effector domain-containing
• DEDD1
• DEDPRO1
• DEFTKE05
• FLDED1
• FLDED-1

Background

DEDD, also known as Death effector domain-containing protein, consists of a 36.8 kDa and a 40.4 kDa isoform and is involved in regulating the degradation of CASP3 in certain substances during apoptosis. Current research is exploring the effect of the protein on diseases such as dental fluorosis and dental caries. The protein is involved in transcription pathways with APLP2, CASP8, DEDD2, SMAD3, and CASP10.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DEDD