Dectin-2/CLEC6A Antibody - BSA Free

Western Blot: DECTIN 2 Antibody [NBP1-59739] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Dectin-2/CLEC6A Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CLEC6A(C-type lectin domain family 6, member A) Antibody(against the N terminal of CLEC6A (NP_001007034). Peptide sequence FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLEC6A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Dectin-2/CLEC6A Antibody - BSA Free

• CLEC4N
• CLEC6A
• CLECSF10
• C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 10
• C-type lectin domain family 6 member A
• C-type lectin domain family 6, member A
• C-type lectin superfamily member 10
• DC-associated C-type lectin 2
• dectin 2
• Dectin2
• Dectin-2
• Dendritic cell-associated C-type lectin 2

Background

CLEC6A may be involved in regulating immune reactivity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLEC6A
• Entrez:
  • 93978(Human)
• Uniprot:
  • Q6EIG7()