Decorin Antibody - BSA Free

Western Blot: Decorin Antibody [NBP3-35694] - Western blot analysis of lysates from Mouse heart, using Decorin Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

Western Blot: Decorin Antibody [NBP3-35694] - Western blot analysis of lysates from HeLa cells, using Decorin Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

Immunocytochemistry/ Immunofluorescence: Decorin Antibody [NBP3-35694] - Immunofluorescence analysis of MCF-7 cells using Decorin Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: Decorin Antibody [NBP3-35694] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using Decorin Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: Decorin Antibody [NBP3-35694] - Immunohistochemistry analysis of paraffin-embedded Human colon using Decorin Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Decorin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Decorin Antibody - BSA Free (NBP3-35694) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 31-359 of Decorin (NP_001911.1).
  
  Sequence:
  GLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DCN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for Decorin Antibody - BSA Free

• Bone proteoglycan II
• CSCD
• DCN
• decorin proteoglycan
• Decorin
• dermatan sulphate proteoglycans II
• DSPG2
• PG40
• PGII
• PG-II
• PGS2
• PG-S2
• proteoglycan core protein
• SLRR1B
• SLRR1BPGS2
• small leucine-rich protein 1B

Background

Decorin is a member of the small, leucine rich proteoglycan (SLRP) family along with biglycan. Found in the interterritorial region of cartilage, decorin interacts with collagen and other matrix proteins to regulate the cartilaginous matrix. It has been shown to interact with fibronectin, thrombospondin, C1q, epidermal growth factor receptor (EGFR), and TGF beta. It is believed that decorin also plays a role in the cell cycle of chondrocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DCN