DEC2/SHARP1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DEC2/SHARP1 Antibody [NBP2-58737] - Staining of human cell line A-431 shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DEC2/SHARP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DEC2/SHARP1 Antibody - BSA Free (NBP2-58737) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PFCLPFCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BHLHE41
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DEC2/SHARP1 Recombinant Protein Antigen (NBP2-58737PEP)

Reactivity Notes

Mouse 86%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DEC2/SHARP1 Antibody - BSA Free

• basic helix-loop-helix domain containing, class B, 3
• basic helix-loop-helix family, member e41
• BHLHB3
• BHLHB3class E basic helix-loop-helix protein 41
• BHLHE41
• Class B basic helix-loop-helix protein 3
• DEC2
• DEC2Enhancer-of-split and hairy-related protein 1
• Differentially expressed in chondrocytes protein 2
• SHARP-1
• SHARP1hDEC2

Background

Human DEC1 is a 412 amino acid, basic helix-loop-helix (bHLH) containing protein that is involved in the control of proliferation and/or differentiation of several cell types including nerve cells, fibroblasts and chondrocytes. The bHLH region of DEC1 is structurally similar to the bHLH regions of the mammalian HES family, Drosophila hairy, and Enhancer of split m7. DEC1 is a novel direct target for cAMP in a wide range of cells, and is involved in the control of gene expression in cAMP-activated cells. DEC2, also known as SHARP1, is highly expressed in skeletal muscle and brain. The gene encoding human DEC2 maps to chromosome 12p11.23-p12.1. DEC1 and DEC2 play a role in regulating the mammalian molecular clock by suppressing the transcription of specific clock genes. Both DEC1 and DEC2 are detected in the suprachiasmimc nucleus in a circadian fashion. Brief light impulses induce the expression of DEC1 in a phase-dependent manner.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BHLHE41