STRA13 Antibody

Images

 
Western Blot: STRA13 Antibody [NBP1-55505] - A549 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STRA13 Antibody Summary

Immunogen
Synthetic peptides corresponding to STRA13(stimulated by retinoic acid 13 homolog (mouse)) The peptide sequence was selected from the middle region of STRA13. Peptide sequence MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STRA13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against STRA13 and was validated on Western blot.
Theoretical MW
7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for STRA13 Antibody

  • BHLHE40
  • CENPX
  • CENP-X
  • DEC1
  • FAAP10
  • FANCM-interacting histone fold protein 2
  • Fanconi anemia-associated polypeptide of 10 kDa
  • HLHB2
  • MGC14480
  • MHF2centromere protein X
  • Retinoic acid-inducible gene D9 protein homolog
  • stimulated by retinoic acid 13 homolog (mouse)
  • stimulated by retinoic acid 13
  • Stimulated by retinoic acid gene 13 protein homolog

Background

STRA13 is a DNA-binding component of the FA core complex involved in DNA damage repair and genome maintenance.STRA13 is recruited to forks stalled by DNA interstrand cross-links, and required for cellular resistance to such lesions. As a component of the APITD1/CENPS complex,STRA13 is also essential for the stable assembly of the outer kinetchore.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP
NBP1-19613
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00378708-B01P
Species: Hu
Applications: WB, ELISA
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
NBP2-50418
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-38290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
AF6539
Species: Hu
Applications: WB, IHC
NBP2-35213
Species: Hu
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for STRA13 Antibody (NBP1-55505) (0)

There are no publications for STRA13 Antibody (NBP1-55505).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STRA13 Antibody (NBP1-55505) (0)

There are no reviews for STRA13 Antibody (NBP1-55505). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STRA13 Antibody (NBP1-55505) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STRA13 Products

STRA13 NBP1-55505

Bioinformatics Tool for STRA13 Antibody (NBP1-55505)

Discover related pathways, diseases and genes to STRA13 Antibody (NBP1-55505). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STRA13 Antibody (NBP1-55505)

Discover more about diseases related to STRA13 Antibody (NBP1-55505).
 

Pathways for STRA13 Antibody (NBP1-55505)

View related products by pathway.

PTMs for STRA13 Antibody (NBP1-55505)

Learn more about PTMs related to STRA13 Antibody (NBP1-55505).

Blogs on STRA13

There are no specific blogs for STRA13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STRA13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STRA13
Uniprot