DEAF1 Antibody

Western Blot: DEAF1 Antibody [NBP2-47489] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Analysis of liver tissue

Immunocytochemistry/Immunofluorescence: DEAF1 Antibody [NBP2-47489] - Staining human cell line U-2 OS shows positivity in nucleus and nucleoli. Antibody staining shown in green.

Immunohistochemistry-Paraffin: DEAF1 Antibody [NBP2-47489] - Staining of human stomach, lower shows strong cytoplasmic and nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DEAF1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSGGRGRCIKQGENWYSPTE
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DEAF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DEAF1 Protein (NBP2-47489PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DEAF1 Antibody

• deformed epidermal autoregulatory factor 1 (Drosophila)
• Nuclear DEAF-1-related transcriptional regulator
• NUDRdeformed epidermal autoregulatory factor 1 homolog
• SPNsuppressin
• Zinc finger MYND domain-containing protein 5
• ZMYND5Suppressin

Background

Transcription factor that binds to sequence with multiple copies of TTC[CG]G present in its own promoter and that of the HNRPA2B1 gene. Down-regulates transcription of these genes. Binds to the retinoic acid response element (RARE) AGGGTTCACCGAAAGTTCA. Activates the proenkephalin gene independently of promoter binding, probably through protein-protein interaction. When secreted, behaves as an inhibitor of cell proliferation, by arresting cells in the G0 or G1 phase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DEAF1