DDX5 Antibody (1K6X10)

Western Blot: DDX5 Antibody (1K6X10) [NBP3-15371] - Western blot analysis of extracts of various cell lines, using DDX5 Rabbit mAb (NBP3-15371) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunofluorescence analysis of NIH-3T3 cells using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunohistochemistry of paraffin-embedded mouse spinal cord using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunocytochemistry/Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunofluorescence analysis of C6 cells using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunofluorescence analysis of HeLa cells using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunohistochemistry of paraffin-embedded rat ovary using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunohistochemistry of paraffin-embedded human esophageal using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunoprecipitation: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunoprecipitation analysis of 600ug extracts of Mouse testis using 3ug DDX5 antibody (NBP3-15371). Western blot was performed from the immunoprecipitate using DDX5 (NBP3-15371) at a dilition of 1:1000.

Immunocytochemistry/ Immunofluorescence: DDX5 Antibody (1K6X10) [DDX5] - Confocal imaging of Hep G2 cells using DDX5 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: DDX5 Antibody (1K6X10) [DDX5] - Confocal imaging of C2C12 cells using DDX5 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: DDX5 Antibody (1K6X10) [DDX5] - Confocal imaging of U-2 OS cells using DDX5 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: DDX5 Antibody (1K6X10) [DDX5] - Western blot analysis of various lysates using DDX5 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IP
• Clone: 1K6X10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

DDX5 Antibody (1K6X10) Summary

• Description: Novus Biologicals Rabbit DDX5 Antibody (1K6X10) (NBP3-15371) is a recombinant monoclonal antibody validated for use in IHC, WB, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDX5 (P17844). MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEAN
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: DDX5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DDX5 Antibody (1K6X10)

• B-cell CLL/lymphoma 7 protein family member C
• B-cell CLL/lymphoma 7C
• DDX5
• DEAD/H
• G17P1
• HELR
• HLR1
• HUMP68

Background

DDX5, also known as Probable ATP-dependent RNA helicase DDX5, is a 69.1 kDa, 613 amino acid protein that regulates pre-mRNA splicing by increasing the inclusion of tau exon 10. Current research with the protein is being conducted for diseases and disorders such as squamous cell carcinoma, breast cancer, fibrosis, prostate cancer, hepatitis, malaria, and myeloma. The protein interacts in translational control and spliceosome pathways with HIST1H4A- HIST1H4E proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX5