DDX18 Antibody - BSA Free

Western Blot: DDX18 Antibody [NBP2-58939] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Immunocytochemistry/Immunofluorescence: DDX18 Antibody [NBP2-58939] - Staining of human cell line A-431 shows localization to nucleoli.

• Reactivity: Hu
• Applications: WB, ICC/IF, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DDX18 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSES
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX18
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DDX18 Recombinant Protein Antigen (NBP2-58939PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DDX18 Antibody - BSA Free

• DEAD (Asp-Glu-Ala-Asp) box polypeptide 18
• DEAD box protein 18
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 18 (Myc-regulated)
• EC 3.6.1
• EC 3.6.4.13
• FLJ33908
• MrDbATP-dependent RNA helicase DDX18
• Myc-regulated DEAD box protein

Background

DDX18, also known as ATP-dependent RNA helicase DDX18, is a 75.4 kDa 670 amino acid protein which is involved in unwinding RNA as a part of the DEAD box protein family. Current research is linking the protein to diseases and disorders such as malaria, arthritis, lung cancer, and neuroblastoma. The protein is involved in transcriptional activation pathways where it interacts with proteins such as HIST1H4A and HIST1H4B.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX18