DDX10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DDX10 Antibody [NBP1-83211] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Immunohistochemistry-Paraffin: DDX10 Antibody [NBP1-83211] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDX10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KVPVKEIKINPEKLIDVQKKLESILAQDQDLKERAQRCFVSYVRSVYLMKDKEVFDVSKLPIPEYALSLGLAVAPRVRFLQKMQKQPTKELVRSQADKVIEPRAPSLTNDEVEEFRAYFNEKMSILQKGGKRLEGTEHRQDNDTGNEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDX10 Protein (NBP1-83211PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDX10 Antibody

  • DDX10-NUP98 fusion protein type 2
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 10
  • DEAD box protein 10
  • DEAD box-10
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 10 (RNA helicase)
  • EC 3.6.1
  • EC 3.6.4.13
  • HRH-J8
  • probable ATP-dependent RNA helicase DDX10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-93325
Species: Hu
Applications: WB, IP
H00027130-P02
Species: Hu
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
H00051428-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00054606-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP2-24632
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC-P
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
H00168400-D01P
Species: Hu
Applications: WB, ELISA
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-87027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47428
Species: Hu
Applications: WB, IHC, IHC-P
21280002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00007150-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-13816
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DDX10 Antibody (NBP1-83211) (0)

There are no publications for DDX10 Antibody (NBP1-83211).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX10 Antibody (NBP1-83211) (0)

There are no reviews for DDX10 Antibody (NBP1-83211). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DDX10 Antibody (NBP1-83211) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX10 Products

Bioinformatics Tool for DDX10 Antibody (NBP1-83211)

Discover related pathways, diseases and genes to DDX10 Antibody (NBP1-83211). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX10 Antibody (NBP1-83211)

Discover more about diseases related to DDX10 Antibody (NBP1-83211).
 

Pathways for DDX10 Antibody (NBP1-83211)

View related products by pathway.

PTMs for DDX10 Antibody (NBP1-83211)

Learn more about PTMs related to DDX10 Antibody (NBP1-83211).

Blogs on DDX10

There are no specific blogs for DDX10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX10