Novus Biologicals products are now on bio-techne.com

DDX1 Antibody

Images

 
Independent Antibodies: Western Blot: DDX1 Antibody [NBP1-85293] - Analysis using Anti-DDX1 antibody NBP1-85293 (A) shows similar pattern to independent antibody NBP1-85294 (B).
Immunocytochemistry/ Immunofluorescence: DDX1 Antibody [NBP1-85293] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85293] - Staining of human colon.
Western Blot: DDX1 Antibody [NBP1-85293] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85293] - Staining of human colon shows strong nuclear positivity in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85293] - Staining of human cerebral cortex, colon, kidney and testis using Anti-DDX1 antibody NBP1-85293 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85293] - Staining of human kidney.
Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85293] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85293] - Staining of human testis.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

DDX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDX1 Protein (NBP1-85293PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDX1 Antibody

  • ATP-dependent RNA helicase DDX1
  • DBP-RB
  • DBP-RBDEAD box polypeptide 1
  • DDX1
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 1
  • DEAD box protein 1
  • DEAD box protein retinoblastoma
  • DEAD Box-1
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1
  • DEAD/H-Box Helicase 1
  • EC 3.6.1
  • EC 3.6.1.10
  • EC 3.6.4.13
  • UKVH5d

Background

DDX1, also known as ATP-dependent RNA helicase DDX1, is an 82.4 kDa 740 amino acid protein and is involved in unwinding RNA helixes and in altering RNA secondary structure. Current research is being conducted for diseases and disorders such as carcinoma, malaria, hepatitis, neuroblastoma, heavy chain disease, prostate cancer, and breast cancer. The protein is involved in mRNA processing pathways with other proteins such as HNRNPK, NBN, SRRM2, RELB, and ATM.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-109
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
NBP2-93277
Species: Hu, Rt
Applications: ICC/IF, WB
NB100-81029
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-31555
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-52457
Species: Ha, Hu, Pm, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IF, IHC, IHC-P, WB
NBP2-32887
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF755
Species: Mu
Applications: Block, WB
AF2780
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
NBP1-80992
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31661
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-40354
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
AF4530
Species: Hu
Applications: ICC, IHC, WB
H00051428-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-89945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-82493
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-20329
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB200-191
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB110-40579
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-85293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for DDX1 Antibody (NBP1-85293) (0)

There are no publications for DDX1 Antibody (NBP1-85293).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX1 Antibody (NBP1-85293) (0)

There are no reviews for DDX1 Antibody (NBP1-85293). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DDX1 Antibody (NBP1-85293) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX1 Products

Research Areas for DDX1 Antibody (NBP1-85293)

Find related products by research area.

Blogs on DDX1

There are no specific blogs for DDX1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX1