DBPA Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DBPA Antibody [NBP1-88049] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: DBPA Antibody [NBP1-88049] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DBPA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSDA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DBPA Protein (NBP1-88049PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DBPA Antibody

  • cold shock domain protein A
  • Cold shock domain-containing protein A
  • cold-shock domain protein A
  • CSDA1
  • dbpA
  • DBPAcold-shock domain containing A1
  • DNA-binding protein A
  • Single-strand DNA-binding protein NF-GMB
  • ZO-1-associated nucleic acid-binding protein
  • ZONAB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NB100-74592
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
H00051380-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP2-19422
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF4986
Species: Hu
Applications: WB
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88049
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for DBPA Antibody (NBP1-88049) (0)

There are no publications for DBPA Antibody (NBP1-88049).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DBPA Antibody (NBP1-88049) (0)

There are no reviews for DBPA Antibody (NBP1-88049). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DBPA Antibody (NBP1-88049) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DBPA Products

Bioinformatics Tool for DBPA Antibody (NBP1-88049)

Discover related pathways, diseases and genes to DBPA Antibody (NBP1-88049). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DBPA Antibody (NBP1-88049)

Discover more about diseases related to DBPA Antibody (NBP1-88049).
 

Pathways for DBPA Antibody (NBP1-88049)

View related products by pathway.

PTMs for DBPA Antibody (NBP1-88049)

Learn more about PTMs related to DBPA Antibody (NBP1-88049).

Blogs on DBPA

There are no specific blogs for DBPA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DBPA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSDA