DBF4B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DBF4B Antibody [NBP2-13900] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: DBF4B Antibody [NBP2-13900] - Staining of human rectum shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DBF4B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HPSQENSFAPADIPVKGPLLFPEARPWLMSARCWVRPFPFVTWGCLIPHD TTPLHEEVSPCPCLRLGYLYLLLTQSLWCRVRVPSLSTAGPIPRTSHPCT LAFPSYLNDHDLGHLCQAKPQGWNTPQPFLHCGFLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DBF4B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
DBF4B Protein (NBP2-13900PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DBF4B Antibody

  • Activator of S phase kinase-like protein 1
  • activator of S-phase kinase-like protein 1
  • ASKL1CHIFB
  • ASK-like protein 1
  • chifb
  • Chiffon homolog B
  • DBF4 homolog B (S. cerevisiae)
  • Dbf4-related factor 1
  • DRF1MGC15009
  • FLJ13087
  • protein DBF4 homolog B
  • ZDBF1B
  • zinc finger, DBF-type containing 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-230
Species: Hu
Applications: WB
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
H00010926-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-247
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-03414
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
AF1444
Species: Mu
Applications: WB, IHC
MAB2878
Species: Hu
Applications: Flow, CyTOF-ready
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13900
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DBF4B Antibody (NBP2-13900) (0)

There are no publications for DBF4B Antibody (NBP2-13900).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DBF4B Antibody (NBP2-13900) (0)

There are no reviews for DBF4B Antibody (NBP2-13900). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DBF4B Antibody (NBP2-13900) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DBF4B Products

Bioinformatics Tool for DBF4B Antibody (NBP2-13900)

Discover related pathways, diseases and genes to DBF4B Antibody (NBP2-13900). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DBF4B

There are no specific blogs for DBF4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DBF4B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DBF4B