DAZAP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82741] - Staining in human testis and liver tissues using NBP1-82741 antibody. Corresponding DAZAP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82741] - Staining of human cerebral cortex, liver, skin and testis using Anti-DAZAP1 antibody NBP1-82741 (A) shows similar protein distribution across tissues to independent antibody NBP1-82740 (B).

Western Blot: DAZAP1 Antibody [NBP1-82741] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: DAZAP1 Antibody [NBP1-82741] - Staining of human cell line U-251 MG shows localization to nucleoplasm and cytosol. Antibody staining is shown in green.

Western Blot: DAZAP1 Antibody [NBP1-82741] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82741] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82741] - Staining of human liver shows no weak positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82741] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82741] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DAZAP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DAZAP1 Antibody - BSA Free (NBP1-82741) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-DAZAP1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DAZAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 28884822). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DAZAP1 Protein (NBP1-82741PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DAZAP1 Antibody - BSA Free

• DAZ associated protein 1
• DAZ-associated protein 1
• deleted in azoospermia associated protein 1
• Deleted in azoospermia-associated protein 1
• MGC19907

Background

In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DAZAP1 Antibody (NBP1-82741)(2)

Publications using NBP1-82741

• Markmiller S, Sathe S, Server KL et al. Persistent mRNA localization defects and cell death in ALS neurons caused by transient cellular stress Cell reports 2021-09-07 [PMID: 34496257]
• Sutherland JM, Sobinoff AP, Fraser BA et al. RNA binding protein Musashi-2 regulates PIWIL1 and TBX1 in mouse spermatogenesis J. Cell. Physiol. 2017-09-08 [PMID: 28884822] (WB, Mouse)

Bioinformatics

• Gene Symbol: DAZAP1