DAK Antibody - BSA Free

Western Blot: DAK Antibody [NBP1-54881] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.

Immunohistochemistry-Paraffin: DAK Antibody [NBP1-54881] - Human tonsil tissue 5ug/ml

Western Blot: DAK Antibody [NBP1-54881] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DAK Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to DAK(dihydroxyacetone kinase 2 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of DAK. Peptide sequence MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DAK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 59 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DAK Antibody - BSA Free

• ATP-dependent dihydroxyacetone kinase
• bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)
• DHA kinase
• Dha kinase/FMN cyclase
• dihydroxyacetone kinase 2 homolog (S. cerevisiae)
• dihydroxyacetone kinase 2 homolog (yeast)
• DKFZP586B1621
• FAD-AMP lyase cyclic FMN forming
• FAD-AMP lyase cyclizing
• glycerone kinase
• MGC5621
• NET45

Background

This gene is a member of the family of dihydroxyacetone kinases, which have a protein structure distinct from other kinases. The product of this gene phosphorylates dihydroxyacetone, and also catalyzes the formation of riboflavin 4',5'-phosphate (aka cycl

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DAK
• Uniprot:
  • Q3LXA3(Human)