DACH1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DACH1 Antibody [NBP1-85320] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: DACH1 Antibody [NBP1-85320] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DACH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASNNQHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNHLQQSHLLPNGLELP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DACH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DACH1 Protein (NBP1-85320PEP)
Publications
Read Publications using
NBP1-85320 in the following applications:

  • IHC
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24392136). Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DACH1 Antibody

  • Dach1
  • DACHdachshund homolog 1
  • dachshund homolog (Drosophila)
  • dachshund homolog 1 (Drosophila)
  • FLJ10138

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
H00000013-M01
Species: Hu
Applications: WB, ELISA
NBP2-14013
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84264
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5230
Species: Hu, Mu
Applications: WB, IHC
NBP2-58069
Species: Hu
Applications: ICC/IF
NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77128
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-58704
Species: Hu
Applications: WB, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF1555
Species: Hu
Applications: WB
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
27550002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-77306
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-82478
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-85320
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for DACH1 Antibody (NBP1-85320)(4)

Reviews for DACH1 Antibody (NBP1-85320) (0)

There are no reviews for DACH1 Antibody (NBP1-85320). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DACH1 Antibody (NBP1-85320) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DACH1 Products

Bioinformatics Tool for DACH1 Antibody (NBP1-85320)

Discover related pathways, diseases and genes to DACH1 Antibody (NBP1-85320). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DACH1 Antibody (NBP1-85320)

Discover more about diseases related to DACH1 Antibody (NBP1-85320).
 

Pathways for DACH1 Antibody (NBP1-85320)

View related products by pathway.

PTMs for DACH1 Antibody (NBP1-85320)

Learn more about PTMs related to DACH1 Antibody (NBP1-85320).
 

Research Areas for DACH1 Antibody (NBP1-85320)

Find related products by research area.

Blogs on DACH1

There are no specific blogs for DACH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DACH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DACH1