Cytokeratin 75 Antibody - BSA Free

Immunohistochemistry-Paraffin: Cytokeratin 75 Antibody [NBP1-87845] - Staining of human hair shows strong cytoplasmic positivity in cells in external root sheath.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cytokeratin 75 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cytokeratin 75 Antibody - BSA Free (NBP1-87845) is a polyclonal antibody validated for use in IHC. Anti-Cytokeratin 75 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KRT75
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Cytokeratin 75 Protein (NBP1-87845PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cytokeratin 75 Antibody - BSA Free

• CK-75
• cytokeratin-75
• hK6hf
• K6HFcytokeratin type II
• K75
• KB18
• keratin 75
• keratin, type II cytoskeletal 75
• Keratin-6 hair follicle
• keratin-75
• PFB
• type II keratin-18
• Type II keratin-K6hf
• Type-II keratin Kb18

Background

Keratin-75 is a protein that plays a central role in hair and nail formation, as it is an important component of the keratin intermediate filaments that are located in the companion layer of the hair follicle, and is 551 amino acids long with a weight of approximately 60 kDa. Studies are being conducted on diseases and disorders related to this protein including loose anagen hair syndrome, pseudofolliculitis barbae, histocytoma, Marek disease, dermatitis, alopecia, pharyngitis, lung cancer, breast cancer, esophagitis, hepatitis, and neuronitis. Keratin-75 has also been shown to have interactions with GABARAP, GABARAPL1, MAP1LC3A, MAR1LC3B, and AMBRA1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cytokeratin 75 Antibody (NBP1-87845)(1)

Publication using NBP1-87845

• Claudia Mazio, Isabella Mavaro, Antonio Palladino, Costantino Casale, Francesco Urciuolo, Andrea Banfi, Livia D'Angelo, Paolo A. Netti, Paolo de Girolamo, Giorgia Imparato, Chiara Attanasio Rapid innervation and physiological epidermal regeneration by bioengineered dermis implanted in mouse Materials Today Bio 2024-01-10 [PMID: 38298559]

Bioinformatics

• Gene Symbol: KRT75