Cytokeratin 75 Antibody

Images

 
Immunohistochemistry-Paraffin: Cytokeratin 75 Antibody [NBP1-87845] - Staining of human hair shows strong cytoplasmic positivity in cells in external root sheath.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytokeratin 75 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT75
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cytokeratin 75 Protein (NBP1-87845PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytokeratin 75 Antibody

  • CK-75
  • cytokeratin-75
  • hK6hf
  • K6HFcytokeratin type II
  • K75
  • KB18
  • keratin 75
  • keratin, type II cytoskeletal 75
  • Keratin-6 hair follicle
  • keratin-75
  • PFB
  • type II keratin-18
  • Type II keratin-K6hf
  • Type-II keratin Kb18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-45538
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF8216
Species: Hu, Mu, Rt
Applications: WB
NB110-40561
Species: Hu
Applications: WB, IP
NBP2-22194
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-87698
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
AF4715
Species: Mu
Applications: WB
NBP1-87845
Species: Hu
Applications: IHC, IHC-P

Publications for Cytokeratin 75 Antibody (NBP1-87845) (0)

There are no publications for Cytokeratin 75 Antibody (NBP1-87845).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 75 Antibody (NBP1-87845) (0)

There are no reviews for Cytokeratin 75 Antibody (NBP1-87845). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cytokeratin 75 Antibody (NBP1-87845) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytokeratin 75 Products

Bioinformatics Tool for Cytokeratin 75 Antibody (NBP1-87845)

Discover related pathways, diseases and genes to Cytokeratin 75 Antibody (NBP1-87845). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 75 Antibody (NBP1-87845)

Discover more about diseases related to Cytokeratin 75 Antibody (NBP1-87845).

Blogs on Cytokeratin 75

There are no specific blogs for Cytokeratin 75, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytokeratin 75 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT75