Cytokeratin 13 Antibody (4F5)

Images

 
Western Blot: Cytokeratin 13 Antibody (4F5) [H00003860-M05] - Analysis of KRT13 expression in transfected 293T cell line by KRT13 monoclonal antibody (M05), clone 4F5. Lane 1: KRT13 transfected lysate (Predicted MW: ...read more
Sandwich ELISA: Cytokeratin 13 Antibody (4F5) [H00003860-M05] - Detection limit for recombinant GST tagged KRT13 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cytokeratin 13 Antibody (4F5) Summary

Immunogen
KRT13 (NP_705694.1 258 a.a. - 357 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYA
Specificity
KRT13 - keratin 13 (4F5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KRT13
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytokeratin 13 Antibody (4F5)

  • CK13
  • CK-13
  • cytokeratin 13
  • Cytokeratin-13
  • K13cytokeratin-13
  • keratin 13
  • keratin, type I cytoskeletal 13
  • keratin-13
  • MGC161462
  • MGC3781

Background

The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. Mutations in this gene and keratin 4 have been associated with the autosomal dominant disorder White Sponge Nevus. The type I cytokeratins are clustered in a region of chromosome 17q21.2. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-32962
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
H00003851-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-22194
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-45538
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-29461
Species: Hu, Bv(-), Ca(-), Ha(-), Mu(-), Po(-), Rt(-), Sh(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-56905
Species: Hu
Applications: WB, ICC/IF
NBP2-34844
Species: Hu, Mu, Bv, Rb
Applications: WB, IHC-Fr, IHC-P
7559-ST
Species: Hu
H00003860-M05
Species: Hu
Applications: WB, ELISA

Publications for Cytokeratin 13 Antibody (H00003860-M05) (0)

There are no publications for Cytokeratin 13 Antibody (H00003860-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 13 Antibody (H00003860-M05) (0)

There are no reviews for Cytokeratin 13 Antibody (H00003860-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytokeratin 13 Antibody (H00003860-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytokeratin 13 Products

Bioinformatics Tool for Cytokeratin 13 Antibody (H00003860-M05)

Discover related pathways, diseases and genes to Cytokeratin 13 Antibody (H00003860-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 13 Antibody (H00003860-M05)

Discover more about diseases related to Cytokeratin 13 Antibody (H00003860-M05).
 

Pathways for Cytokeratin 13 Antibody (H00003860-M05)

View related products by pathway.

PTMs for Cytokeratin 13 Antibody (H00003860-M05)

Learn more about PTMs related to Cytokeratin 13 Antibody (H00003860-M05).
 

Research Areas for Cytokeratin 13 Antibody (H00003860-M05)

Find related products by research area.

Blogs on Cytokeratin 13

There are no specific blogs for Cytokeratin 13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytokeratin 13 Antibody (4F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT13
Entrez
Uniprot