Cytochrome c Antibody (6R10F3)

Western Blot: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Western blot analysis of extracts of various cell lines, using Cytochrome c Rabbit mAb (NBP3-16512) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Immunohistochemistry of paraffin-embedded human appendix using Cytochrome c Rabbit mAb (NBP3-16512) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Immunohistochemistry of paraffin-embedded rat kidney using Cytochrome c Rabbit mAb (NBP3-16512) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Cytochrome c Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Cytochrome c Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Cytochrome c Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Cytochrome c Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Cytochrome c Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ELISA, IHC
• Clone: 6R10F3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Cytochrome c Antibody (6R10F3) Summary

• Description: Novus Biologicals Rabbit Cytochrome c Antibody (6R10F3) (NBP3-16512) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-105 of human Cytochrome C (P99999). MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CYCS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Simple Western
  • Western Blot 1:500 - 1:1000
• Application Notes: Simple Western validated by ProteinSimple, Inc.
  See Simple Western Antibody Database for Simple Western validation
• Theoretical MW: 12 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cytochrome c Antibody (6R10F3)

• CYCHCS
• CYCS
• Cytochrome c
• cytochrome c, somatic
• THC4

Background

In addition to its well-known role in electron-transport, cytochrome c (CYT) has been identified as a mediator of apoptosis or programmed cell death (1). Cytochrome c translocates from mitochondria into the cytoplasm in the early phases of apoptosis and plays a role in initiation of the apoptotic proteolytic cascade bay activating caspase-3 (2). Cytochrome c has been shown to bind Apaf-1. Apaf-1 has also been shown to activate capase-3 (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYCS