CYTIP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CYTIP Antibody [NBP1-88946] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CYTIP Antibody [NBP1-88946] - Staining of human lymph node shows cytoplasmic positivity in non-germinal and germinal center.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYTIP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PAYSSYSTLTGSLTMDDNRRIQMLADTVATLPRGRKQLALTRSSSLSDFSWSQRKLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTEGF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYTIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CYTIP Protein (NBP1-88946PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CYTIP Antibody

  • B3-1
  • CASPCytohesin-associated scaffolding protein
  • Cbp HE
  • CYBRCytohesin-binding protein HE
  • CYTHIP
  • cytohesin 1 interacting protein
  • Cytohesin binder and regulator
  • cytohesin-1 interacting protein
  • cytohesin-interacting protein
  • HEPleckstrin homology Sec7 and coiled-coil domains-binding protein
  • pleckstrin homology, Sec7 and coiled/coil domains, binding protein
  • pleckstrin homology, Sec7 and coiled-coil domains, binding protein
  • PSCDBPcytohesin binding protein HE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56115
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF826
Species: Hu, Mu
Applications: WB
NBP1-77209
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IF
NB100-56114
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76602
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-83352
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CYTIP Antibody (NBP1-88946) (0)

There are no publications for CYTIP Antibody (NBP1-88946).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYTIP Antibody (NBP1-88946) (0)

There are no reviews for CYTIP Antibody (NBP1-88946). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CYTIP Antibody (NBP1-88946) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYTIP Products

Bioinformatics Tool for CYTIP Antibody (NBP1-88946)

Discover related pathways, diseases and genes to CYTIP Antibody (NBP1-88946). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYTIP Antibody (NBP1-88946)

Discover more about diseases related to CYTIP Antibody (NBP1-88946).
 

Pathways for CYTIP Antibody (NBP1-88946)

View related products by pathway.

PTMs for CYTIP Antibody (NBP1-88946)

Learn more about PTMs related to CYTIP Antibody (NBP1-88946).

Blogs on CYTIP

There are no specific blogs for CYTIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYTIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYTIP