Cystatin C Antibody - BSA Free

Immunohistochemistry-Paraffin: Cystatin C Antibody [NBP1-87472] - Staining in human salivary gland and skeletal muscle tissues using anti-CST3 antibody. Corresponding CST3 RNA-seq data are presented for the same tissues.

Western Blot: Cystatin C Antibody [NBP1-87472] - Analysis in human cell lines PC-3 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Immunocytochemistry/Immunofluorescence: Cystatin C Antibody [NBP1-87472] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus and vesicles.

Immunohistochemistry-Paraffin: Cystatin C Antibody [NBP1-87472] - Staining of human salivary gland shows high expression.

Immunohistochemistry-Paraffin: Cystatin C Antibody [NBP1-87472] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cystatin C Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CST3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Cystatin C Protein (NBP1-87472PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cystatin C Antibody - BSA Free

• ARMD11
• bA218C14.4 (cystatin C)
• CST3
• cystatin 3
• cystatin C (amyloid angiopathy and cerebral hemorrhage)
• Cystatin C
• cystatin-3
• cystatin-C
• Gamma-trace
• MGC117328
• Neuroendocrine basic polypeptide
• Post-gamma-globulin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cystatin C Antibody (NBP1-87472)(1)

Publication using NBP1-87472

• Wu CC, Hsu CW, Chen CD et al. Candidate Serological Biomarkers for Cancer Identified from the Secretomes of 23 Cancer Cell Lines and the Human Protein Atlas. Mol Cell Proteomics 2010-06-01 [PMID: 20124221]

Bioinformatics

• Gene Symbol: CST3