Cystatin C Antibody

Images

 
Western Blot: Cystatin C Antibody [NBP1-87472] - Analysis in human cell line HepG2.
Immunocytochemistry/ Immunofluorescence: Cystatin C Antibody [NBP1-87472] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: Cystatin C Antibody [NBP1-87472] - Staining of human salivary gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cystatin C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CST3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cystatin C Protein (NBP1-87472PEP)
Publications
Read Publication using NBP1-87472.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cystatin C Antibody

  • ARMD11
  • bA218C14.4 (cystatin C)
  • CST3
  • cystatin 3
  • cystatin C (amyloid angiopathy and cerebral hemorrhage)
  • Cystatin C
  • cystatin-3
  • cystatin-C
  • Gamma-trace
  • MGC117328
  • Neuroendocrine basic polypeptide
  • Post-gamma-globulin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1857
Species: Mu
Applications: WB, Simple Western, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF1286
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF5739
Species: Hu, Mu, Rt
Applications: WB

Publications for Cystatin C Antibody (NBP1-87472)(1)

Reviews for Cystatin C Antibody (NBP1-87472) (0)

There are no reviews for Cystatin C Antibody (NBP1-87472). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cystatin C Antibody (NBP1-87472) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cystatin C Products

Bioinformatics Tool for Cystatin C Antibody (NBP1-87472)

Discover related pathways, diseases and genes to Cystatin C Antibody (NBP1-87472). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cystatin C Antibody (NBP1-87472)

Discover more about diseases related to Cystatin C Antibody (NBP1-87472).
 

Pathways for Cystatin C Antibody (NBP1-87472)

View related products by pathway.

PTMs for Cystatin C Antibody (NBP1-87472)

Learn more about PTMs related to Cystatin C Antibody (NBP1-87472).

Blogs on Cystatin C

There are no specific blogs for Cystatin C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cystatin C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CST3
Entrez