CYP7B1 Recombinant Protein Antigen

Images

 
There are currently no images for CYP7B1 Protein (NBP1-87013PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CYP7B1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CYP7B1.

Source: E. coli

Amino Acid Sequence: VRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLESSIFEALRLSSYSTTIRFVEEDLTLSSETGDYCVRKGDLVAIFPPVLHGDPEIFEAPEEFRYDRFIEDGKKKTTFFKRGKKLKCYLMPFGTGTSKC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CYP7B1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87013.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CYP7B1 Recombinant Protein Antigen

  • CBAS3
  • CP7B
  • Cytochrome P450 7B1
  • cytochrome P450, family 7, subfamily B, polypeptide 1
  • cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1,25-hydroxycholesterol 7-alpha-hydroxylase
  • EC 1.14.13.100
  • Oxysterol 7-alpha-hydroxylase
  • oxysterol 7alpha-hydroxylase
  • spastic paraplegia 5A (autosomal recessive)
  • SPG5A

Background

P450 enzymes constitute a family of monooxygenase enzymes that are involved in the metabolism of a wide array of endogenous and xenobiotic compounds including cholesterol. CYP8B1 moderates the ratio of cholic acid over chenodeoxycholic acid to control the solubility of cholesterol. P450 cholesterol 7-hydroxylase, CYP7A1, is the rate limiting enzyme of bile acid synthesis in the liver, and its expression is mediated by the bile acid receptor FXR. CYP27A1 catalyzes vitamin D3 25-hydroxylation and is localized to the mitochondria in kidney and liver. CYP7B1 (oxysterol 7-alpha-hydroxylase) functions as an enzyme in the alternate bile acid synthesis pathway. Specifically, CYP7B1 metabolizes 25- and 27-hydroxycholesterol. The gene encoding human CYP7B1 maps to chromosome 8q21.3. Mutations in the CYP7B1 gene may cause a metabolic defect in bile acid synthesis characterized by elevated urinary bile acid excretion, severe cholestasis, cirrhosis and liver synthetic failure.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32433
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB9120
Species: Hu
Applications: ICC
PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NB200-305
Species: Hu, Pm, Mu
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP1-68884
Species: Hu
Applications: WB
NBP2-50206
Species: Hu
Applications: ELISA, IHC, WB
NBP1-52813
Species: Hu, Rt
Applications: ICC/IF,  IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PAGE, WB
NBP1-89680
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, Simple Western, WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP1-87013PEP
Species: Hu
Applications: AC

Publications for CYP7B1 Protein (NBP1-87013PEP) (0)

There are no publications for CYP7B1 Protein (NBP1-87013PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP7B1 Protein (NBP1-87013PEP) (0)

There are no reviews for CYP7B1 Protein (NBP1-87013PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CYP7B1 Protein (NBP1-87013PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYP7B1 Products

Research Areas for CYP7B1 Protein (NBP1-87013PEP)

Find related products by research area.

Blogs on CYP7B1

There are no specific blogs for CYP7B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CYP7B1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP7B1