CYP7B1 Antibody [CoraFluor™ 1]

Product Discontinued

CYP7B1 Antibody [CoraFluor™ 1] Summary

• Description: CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(TM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.
  
  CoraFluor(TM) 1, amine reactive
  
  CoraFluor(TM) 1, thiol reactive
  
  For more information, please see our CoraFluor(TM) TR-FRET technology flyer.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYP7B1 (NP_004811.1).
  
  Sequence:
  VIVCDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHHLGFLWASVANTIPT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CYP7B1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark. Do not freeze.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Affinity purified

Notes

CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254

Alternate Names for CYP7B1 Antibody [CoraFluor™ 1]

• CBAS3
• CP7B
• Cytochrome P450 7B1
• cytochrome P450, family 7, subfamily B, polypeptide 1
• cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1,25-hydroxycholesterol 7-alpha-hydroxylase
• EC 1.14.13.100
• Oxysterol 7-alpha-hydroxylase
• oxysterol 7alpha-hydroxylase
• spastic paraplegia 5A (autosomal recessive)
• SPG5A

Background

P450 enzymes constitute a family of monooxygenase enzymes that are involved in the metabolism of a wide array of endogenous and xenobiotic compounds including cholesterol. CYP8B1 moderates the ratio of cholic acid over chenodeoxycholic acid to control the solubility of cholesterol. P450 cholesterol 7-hydroxylase, CYP7A1, is the rate limiting enzyme of bile acid synthesis in the liver, and its expression is mediated by the bile acid receptor FXR. CYP27A1 catalyzes vitamin D3 25-hydroxylation and is localized to the mitochondria in kidney and liver. CYP7B1 (oxysterol 7-alpha-hydroxylase) functions as an enzyme in the alternate bile acid synthesis pathway. Specifically, CYP7B1 metabolizes 25- and 27-hydroxycholesterol. The gene encoding human CYP7B1 maps to chromosome 8q21.3. Mutations in the CYP7B1 gene may cause a metabolic defect in bile acid synthesis characterized by elevated urinary bile acid excretion, severe cholestasis, cirrhosis and liver synthetic failure.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYP7B1