CYP7B1 Antibody [Alexa Fluor® 488] Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYP7B1 (NP_004811.1).
Sequence: VIVCDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHHLGFLWASVANTIPT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CYP7B1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for CYP7B1 Antibody [Alexa Fluor® 488]
Background
P450 enzymes constitute a family of monooxygenase enzymes that are involved in the metabolism of a wide array of endogenous and xenobiotic compounds including cholesterol. CYP8B1 moderates the ratio of cholic acid over chenodeoxycholic acid to control the solubility of cholesterol. P450 cholesterol 7-hydroxylase, CYP7A1, is the rate limiting enzyme of bile acid synthesis in the liver, and its expression is mediated by the bile acid receptor FXR. CYP27A1 catalyzes vitamin D3 25-hydroxylation and is localized to the mitochondria in kidney and liver. CYP7B1 (oxysterol 7-alpha-hydroxylase) functions as an enzyme in the alternate bile acid synthesis pathway. Specifically, CYP7B1 metabolizes 25- and 27-hydroxycholesterol. The gene encoding human CYP7B1 maps to chromosome 8q21.3. Mutations in the CYP7B1 gene may cause a metabolic defect in bile acid synthesis characterized by elevated urinary bile acid excretion, severe cholestasis, cirrhosis and liver synthetic failure.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC
Species: Hu
Applications: DirELISA, IHC, IP, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm, Mu
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Publications for CYP7B1 Antibody (NBP3-35797AF488) (0)
There are no publications for CYP7B1 Antibody (NBP3-35797AF488).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CYP7B1 Antibody (NBP3-35797AF488) (0)
There are no reviews for CYP7B1 Antibody (NBP3-35797AF488).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CYP7B1 Antibody (NBP3-35797AF488) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CYP7B1 Products
Research Areas for CYP7B1 Antibody (NBP3-35797AF488)
Find related products by research area.
|
Blogs on CYP7B1