CYP46A1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit CYP46A1 Antibody - BSA Free (NBP2-92925) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 24-280 of human CYP46A1 (NP_006659.1). HRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQIL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CYP46A1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CYP46A1 Antibody - BSA Free
Background
CYP46A1 (cytochrome P450, family 46, subfamily A, polypeptide 1) belongs to the cytochrome P450 family which consist of a variety of enzymes that are involved in catalyzing reactions. CYP46A1 is expressed in the brain and is involved in turnover of cholesterol through the conversion of cholesterol to 24S-hydroxycholesterol. CYP46A1 is known to have interactions with CH25H, CYP27A1, CYP39A1, CYP7A1 and CEL. Recent studies of CYP46A1 have been conducted in relation to Alzheimer's disease.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Publications for CYP46A1 Antibody (NBP2-92925) (0)
There are no publications for CYP46A1 Antibody (NBP2-92925).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CYP46A1 Antibody (NBP2-92925) (0)
There are no reviews for CYP46A1 Antibody (NBP2-92925).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CYP46A1 Antibody (NBP2-92925) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CYP46A1 Products
Research Areas for CYP46A1 Antibody (NBP2-92925)
Find related products by research area.
|
Blogs on CYP46A1