CYP2U1 Antibody

Images

 
Immunohistochemistry: CYP2U1 Antibody [NBP2-30991] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP2U1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFIDMYLLHMEEERK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP2U1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CYP2U1 Protein (NBP2-30991PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CYP2U1 Antibody

  • cytochrome P450 2U1
  • cytochrome P450, family 2, subfamily U, polypeptide 1
  • EC 1.14.14.1
  • P450TEC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50204
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP2-30043
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-83659
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP2-15079
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14922
Species: Hu
Applications: WB
NBP2-01286
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-16064
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86142
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85361
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-50216
Species: Hu
Applications: WB, ELISA, IHC

Publications for CYP2U1 Antibody (NBP2-30991) (0)

There are no publications for CYP2U1 Antibody (NBP2-30991).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP2U1 Antibody (NBP2-30991) (0)

There are no reviews for CYP2U1 Antibody (NBP2-30991). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CYP2U1 Antibody (NBP2-30991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP2U1 Products

Bioinformatics Tool for CYP2U1 Antibody (NBP2-30991)

Discover related pathways, diseases and genes to CYP2U1 Antibody (NBP2-30991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP2U1 Antibody (NBP2-30991)

Discover more about diseases related to CYP2U1 Antibody (NBP2-30991).
 

Pathways for CYP2U1 Antibody (NBP2-30991)

View related products by pathway.

PTMs for CYP2U1 Antibody (NBP2-30991)

Learn more about PTMs related to CYP2U1 Antibody (NBP2-30991).

Blogs on CYP2U1

There are no specific blogs for CYP2U1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP2U1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP2U1
Uniprot