CYP2F1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit CYP2F1 Antibody - BSA Free (NBP2-92810) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 100-290 of human CYP2F1 (NP_000765.2). DYPAFFNFTKGNGIAFSSGDRWKVLRQFSIQILRNFGMGKRSIEERILEEGSFLLAELRKTEGEPFDPTFVLSRSVSNIICSVLFGSRFDYDDERLLTIIRLINDNFQIMSSPWGELYDIFPSLLDWVPGPHQRIFQNFKCLRDLIAHSVHDHQASLDPRSPRDFIQCFLTKMAEEKEDPLSHFHMDTLLM |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CYP2F1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50-1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CYP2F1 Antibody - BSA Free
Background
CYP2F1, or Cytochrome P450 2F1, consists of a 491 amino acid isoform that is 56 kDa, and is involved in drug metabolism, cholesterol, steroid, and lipid synthesis, and the dealkylation of pentoxyresorufin, ethoxycoumarin, and propoxycoumarin. Current research is being conducted with CYP2F1 and a variety of diseases and disorders, including ovarian cancer, metastasis, cholesterol, vaccinia, and colorectal cancer, to determine the relationship between the protein and the disease. CYP2F1 interacts with ADH1A, ADH1B, ALDH1A3, EPHX1, and GSTA1 in biological processes such as metapathway biotransformation, biological oxidations, and CYP2E1 reactions.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Rt
Applications: WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, WB
Publications for CYP2F1 Antibody (NBP2-92810) (0)
There are no publications for CYP2F1 Antibody (NBP2-92810).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CYP2F1 Antibody (NBP2-92810) (0)
There are no reviews for CYP2F1 Antibody (NBP2-92810).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CYP2F1 Antibody (NBP2-92810) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CYP2F1 Products
Research Areas for CYP2F1 Antibody (NBP2-92810)
Find related products by research area.
|
Blogs on CYP2F1