CYP21A2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-38698] - Analysis in human adrenal gland and kidney tissues using NBP2-38698 antibody. Corresponding CYP21A2 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-38698] - Staining of human adrenal gland, kidney, pancreas and testis using Anti-CYP21A2 antibody NBP2-38698 (A) shows similar protein ...read more
Western Blot: CYP21A2 Antibody [NBP2-38698] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Adrenal Gland tissue
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-38698] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-38698] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells in adrenal cortex.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-38698] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-38698] - Staining of human kidney shows no positivity in cells in tubules as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP21A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LIGGTETTANTLSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP21A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CYP21A2 Protein (NBP2-38698PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CYP21A2 Antibody

  • 21-OHase
  • CA21HCYP21B
  • CAH1
  • CPS1
  • CYP21EC 1.14.99.10
  • Cytochrome P450 21
  • Cytochrome P450 XXI
  • cytochrome P450, family 21, subfamily A, polypeptide 2
  • cytochrome P450, subfamily XXIA (steroid 21-hydroxylase, congenital adrenalhyperplasia), polypeptide 2
  • Cytochrome P-450c21
  • Cytochrome P450-C21
  • Cytochrome P450-C21B
  • EC 1.14.99
  • MGC150536
  • MGC150537
  • P450c21B
  • steroid 21-hydroxylase
  • steroid 21-monooxygenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-66995
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-68883
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-01151
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NB200-541
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP3-12295
Species: Hu, Pm, Rt
Applications: ELISA, IHC, IP, WB
NBP1-85368
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92862
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF6999
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-32353
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-46290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93797
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for CYP21A2 Antibody (NBP2-38698) (0)

There are no publications for CYP21A2 Antibody (NBP2-38698).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP21A2 Antibody (NBP2-38698) (0)

There are no reviews for CYP21A2 Antibody (NBP2-38698). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP21A2 Antibody (NBP2-38698) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CYP21A2 Products

Bioinformatics Tool for CYP21A2 Antibody (NBP2-38698)

Discover related pathways, diseases and genes to CYP21A2 Antibody (NBP2-38698). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP21A2 Antibody (NBP2-38698)

Discover more about diseases related to CYP21A2 Antibody (NBP2-38698).
 

Pathways for CYP21A2 Antibody (NBP2-38698)

View related products by pathway.

PTMs for CYP21A2 Antibody (NBP2-38698)

Learn more about PTMs related to CYP21A2 Antibody (NBP2-38698).
 

Research Areas for CYP21A2 Antibody (NBP2-38698)

Find related products by research area.

Blogs on CYP21A2

There are no specific blogs for CYP21A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP21A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP21A2
Uniprot