![Western Blot: Cyclin B1 Antibody [NBP2-56867] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/fullsize/Cyclin-B1-Antibody-Western-Blot-NBP2-56867-img0003.jpg "Western Blot: Cyclin B1 Antibody [NBP2-56867] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Cyclin B1 Antibody - BSA Free (NBP2-56867) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CCNB1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Cyclin B1 Antibody (NBP2-56867)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CCNB1 |
![Immunocytochemistry/Immunofluorescence: Cyclin B1 Antibody [NBP2-56867] - Staining of human cell line A549 shows localization to cytosol.](http://images.novusbio.com/fullsize/Cyclin-B1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56867-img0001.jpg "Immunocytochemistry/Immunofluorescence: Cyclin B1 Antibody [NBP2-56867] - Staining of human cell line A549 shows localization to cytosol.")
![Immunohistochemistry-Paraffin: Cyclin B1 Antibody [NBP2-56867] - Staining in human testis and pancreas tissues using anti-CCNB1 antibody. Corresponding CCNB1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Cyclin-B1-Antibody-Immunohistochemistry-Paraffin-NBP2-56867-img0007.jpg "Immunohistochemistry-Paraffin: Cyclin B1 Antibody [NBP2-56867] - Staining in human testis and pancreas tissues using anti-CCNB1 antibody. Corresponding CCNB1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry: Cyclin B1 Antibody [NBP2-56867] - Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.](http://images.novusbio.com/fullsize/Cyclin-B1-Antibody-Immunohistochemistry-NBP2-56867-img0004.jpg "Immunohistochemistry: Cyclin B1 Antibody [NBP2-56867] - Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.")
![Immunohistochemistry-Paraffin: Cyclin B1 Antibody [NBP2-56867] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/Cyclin-B1-Antibody-Immunohistochemistry-Paraffin-NBP2-56867-img0005.jpg "Immunohistochemistry-Paraffin: Cyclin B1 Antibody [NBP2-56867] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: Cyclin B1 Antibody [NBP2-56867] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/Cyclin-B1-Antibody-Immunohistochemistry-Paraffin-NBP2-56867-img0006.jpg "Immunohistochemistry-Paraffin: Cyclin B1 Antibody [NBP2-56867] - Staining of human testis shows high expression.")
![Western Blot CDC25C Antibody (461908) [Unconjugated]](https://images.novusbio.com/images2/CDC25C_MAB4459_Western_Blot_6183.jpg)
![Western Blot CDC25C Antibody (461908) [Unconjugated]](https://images.novusbio.com/images/mab4459_human-mouse-rat-cdc25c-mab-clone-461908-western-blot-12122025813161.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot Bax Antibody [Unconjugated]](https://images.novusbio.com/images2/Bax_AF820_Western_Blot_5909.jpg)
![Immunocytochemistry Bax Antibody [Unconjugated]](https://images.novusbio.com/images2/Bax_AF820_Immunocytochemistry__Immunofluorescence_22092.jpg)
![Knockout Validated Bax Antibody [Unconjugated]](https://images.novusbio.com/images2/Bax_AF820_Knockout_Validated_22544.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")