CXXC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CXXC1 Antibody [NBP1-91816] - Immunofluorescent staining of human cell line HeLa shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP1-91816] - Staining of human Staining of human lymph node. shows strong nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP1-91816] - Staining of human stomach shows nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXXC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VKVKHVKRREKKSEKKKEERYKRHRQKQKHKDKWKHPERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILRAKQQ
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CXXC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CXXC1 Protein (NBP1-91816PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CXXC1 Antibody

  • CFP1CXXC-type zinc finger protein 1
  • CGBPPHD finger and CXXC domain-containing protein 1
  • CpG binding protein
  • cpG-binding protein
  • CXXC finger 1 (PHD domain)
  • CXXC finger protein 1
  • DNA-binding protein with PHD finger and CXXC domain
  • hCGBP
  • HsT2645
  • PCCX12410002I16Rik
  • PHF185830420C16Rik
  • SPP1
  • ZCGPC1
  • zinc finger, CpG binding-type containing 1

Background

Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression (Carlone and Skalnik, 2001 (PubMed 11604496)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CXXC1 Antibody (NBP1-91816) (0)

There are no publications for CXXC1 Antibody (NBP1-91816).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXXC1 Antibody (NBP1-91816) (0)

There are no reviews for CXXC1 Antibody (NBP1-91816). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CXXC1 Antibody (NBP1-91816) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXXC1 Products

Research Areas for CXXC1 Antibody (NBP1-91816)

Find related products by research area.

Blogs on CXXC1

There are no specific blogs for CXXC1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXXC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CXXC1