We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CXCR4 Antibody (1F8)

Images

 
Western Blot: CXCR4 Antibody (1F8) [H00007852-M02] - CXCR4 monoclonal antibody (M02), clone 1F8. Analysis of CXCR4 expression in human Intestinal wall.

Product Details

Summary
Product Discontinued
View other related CXCR4 Primary Antibodies

Order Details


    • Catalog Number
      H00007852-M02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CXCR4 Antibody (1F8) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
Specificity
CXCR4 (1F8)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CXCR4
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Publications
Read Publication using H00007852-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CXCR4 Antibody (1F8)

  • CD184
  • chemokine (C-X-C motif) receptor 4
  • chemokine (C-X-C motif), receptor 4 (fusin)
  • C-X-C chemokine receptor type 4
  • CXCR4
  • CXC-R4
  • CXCR-4
  • D2S201E
  • D2S201ESDF-1 receptor
  • FB22
  • Fusin
  • HM89
  • HM89NPYRL
  • HSY3RR
  • LAP3
  • LAP-3
  • LCR1
  • LESTR
  • LESTRCD184 antigen
  • Leukocyte-derived seven transmembrane domain receptor
  • leukocyte-derived seven-transmembrane-domain receptor
  • lipopolysaccharide-associated protein 3
  • neuropeptide Y receptor Y3
  • NPY3R
  • NPY3RWHIM
  • NPYR
  • NPYRL
  • NPYY3R
  • pCXCR4
  • seven transmembrane helix receptor
  • seven-transmembrane-segment receptor, spleen
  • Stromal cell-derived factor 1 receptor
  • WHIMS

Background

CD184, also known as fusin or CXCR4, is a 45 kD seven transmembrane G-protein-linked CXC chemokine receptor. CD184 is widely expressed on blood and tissue cells, including B and T cells, monocytes, macrophages, dendritic cells, granulocytes, megakaryocytes/platelets, lymphoid, myeloid precursor cells, endothelial cells, epithelial cells, astrocytes, and neurons, among other tissue cells. CD184 is the receptor for CXC chemokine SDF-1, mediates blood cell migration, and is involved in B lympho- and myelopoiesis, cardiogenesis, blood vessel formation and cerebellar development. CXCR4 is also a coreceptor of X4 HIV-1 and an alternative receptor for some isolates of HIV-2. The 12G5 antibody has been reported to block CD4-independent infection by HIV-2 and CD4-dependent infection by some T cell-tropic isolates of HIV-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB600-1071
Species: Hu(-), Mu
Applications: COMET, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, mIF, WB
DVE00
Applications: ELISA
DRN00B
Applications: ELISA
MAB155
Applications: CyTOF-ready, Flow, IHC, Neut
MAB197
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
7268-CT
Applications: BA
AF1230
Applications: IHC, KO, WB
AF887
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB160
Applications: CyTOF-ready, Flow, IHC, Neut

Publications for CXCR4 Antibody (H00007852-M02)(1)

Reviews for CXCR4 Antibody (H00007852-M02) (0)

There are no reviews for CXCR4 Antibody (H00007852-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXCR4 Antibody (H00007852-M02). (Showing 1 - 1 of 1 FAQ).

  1. Which is your best CXCR4 for immunohistochemistry in paraffin tissues? I would like to detect it in paraffin embedded tissues from human breast cancer samples.
    • CXCR4 antibody (NB100-74396) is our best selling product among all the CXCR4 antibodies and it has been validated for IHC-P in human cervical carcinoma tissue sections. NB100-74396 has been cited in at least 7 research publications. Additionally, here is a list of all of our CXCR4 antibodies that has been verified in IHC-P in human samples.

Secondary Antibodies

 

Isotype Controls

Additional CXCR4 Products

Research Areas for CXCR4 Antibody (H00007852-M02)

Find related products by research area.

Blogs on CXCR4.

Stemness is responsible for onset and metastasis of colorectal cancer
By Jamshed Arslan, Pharm. D., PhD. Colorectal cancer stem cells are a rare subpopulation of colorectal cancer cells that can self-renew and initiate and sustain tumor growth when transplanted into an animal host.1,2 C...  Read full blog post.

LAMP2: Protector of the lysosome
LAMP2 belongs to the family of membrane glycoproteins who confer selectins with carbohydrate ligands. LAMP2 has been implicated in tumor cell metastasis, as well as overall protection, maintenance, and adhesion of the lysosome. It appears that LAMP2 m...  Read full blog post.

CXCR4 Studies on Neural and Stem Cells
The CXCR4 (C-X-C chemokine receptor type 4) protein is one member of the G-protein coupled receptor (GPCR1) family. As a multipass membrane protein that is found in several tissues, it is the receptor for the C-X-C chemokine CXCL12/SDF-1. The CXCR4 li...  Read full blog post.

Understanding CXCR4 and SDF1
CXCR4 (C-X-C chemokine receptor type 4) is a member of the G-protein coupled receptor (GPCR1) family. It is expressed as a multipass membrane protein in several tissues where it acts as the receptor for the C-X-C chemokine CXCL12/SDF-1. This ligand in...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXCR4 Antibody (1F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CXCR4