CXCR4 Antibody (1F8)

Western Blot: CXCR4 Antibody (1F8) [H00007852-M02] - CXCR4 monoclonal antibody (M02), clone 1F8. Analysis of CXCR4 expression in human Intestinal wall.

Product Discontinued

CXCR4 Antibody (1F8) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
• Specificity: CXCR4 (1F8)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CXCR4
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CXCR4 Antibody (1F8)

• CD184
• chemokine (C-X-C motif) receptor 4
• chemokine (C-X-C motif), receptor 4 (fusin)
• C-X-C chemokine receptor type 4
• CXCR4
• CXC-R4
• CXCR-4
• D2S201E
• D2S201ESDF-1 receptor
• FB22
• Fusin
• HM89
• HM89NPYRL
• HSY3RR
• LAP3
• LAP-3
• LCR1
• LESTR
• LESTRCD184 antigen
• Leukocyte-derived seven transmembrane domain receptor
• leukocyte-derived seven-transmembrane-domain receptor
• lipopolysaccharide-associated protein 3
• neuropeptide Y receptor Y3
• NPY3R
• NPY3RWHIM
• NPYR
• NPYRL
• NPYY3R
• pCXCR4
• seven transmembrane helix receptor
• seven-transmembrane-segment receptor, spleen
• Stromal cell-derived factor 1 receptor
• WHIMS

Background

CD184, also known as fusin or CXCR4, is a 45 kD seven transmembrane G-protein-linked CXC chemokine receptor. CD184 is widely expressed on blood and tissue cells, including B and T cells, monocytes, macrophages, dendritic cells, granulocytes, megakaryocytes/platelets, lymphoid, myeloid precursor cells, endothelial cells, epithelial cells, astrocytes, and neurons, among other tissue cells. CD184 is the receptor for CXC chemokine SDF-1, mediates blood cell migration, and is involved in B lympho- and myelopoiesis, cardiogenesis, blood vessel formation and cerebellar development. CXCR4 is also a coreceptor of X4 HIV-1 and an alternative receptor for some isolates of HIV-2. The 12G5 antibody has been reported to block CD4-independent infection by HIV-2 and CD4-dependent infection by some T cell-tropic isolates of HIV-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CXCR4 Antibody (H00007852-M02)(1)

Publication using H00007852-M02

• Patrussi L, Capitani N, Cannizzaro E et al. Negative regulation of chemokine receptor signaling and B-cell chemotaxis by p66Shc. Cell Death Dis. 2014-02-20 [PMID: 24556683]

FAQs for CXCR4 Antibody (H00007852-M02). (Showing 1 - 1 of 1 FAQ).

1. Which is your best CXCR4 for immunohistochemistry in paraffin tissues? I would like to detect it in paraffin embedded tissues from human breast cancer samples.
   • CXCR4 antibody (NB100-74396) is our best selling product among all the CXCR4 antibodies and it has been validated for IHC-P in human cervical carcinoma tissue sections. NB100-74396 has been cited in at least 7 research publications. Additionally, here is a list of all of our CXCR4 antibodies that has been verified in IHC-P in human samples.

Bioinformatics

• Gene Symbol: CXCR4