CXCR4 Antibody (1F8)


Western Blot: CXCR4 Antibody (1F8) [H00007852-M02] - CXCR4 monoclonal antibody (M02), clone 1F8. Analysis of CXCR4 expression in human Intestinal wall.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

CXCR4 Antibody (1F8) Summary

CXCR4 (AAH20968, 1 a.a. - 46 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
CXCR4 (1F8)
IgG1 Kappa
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Positive Control
CXCR4 Lysate (NBP2-64936)
Read Publication using H00007852-M02.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CXCR4 Antibody (1F8)

  • CD184
  • chemokine (C-X-C motif) receptor 4
  • chemokine (C-X-C motif), receptor 4 (fusin)
  • C-X-C chemokine receptor type 4
  • CXCR4
  • CXC-R4
  • CXCR-4
  • D2S201ESDF-1 receptor
  • FB22
  • Fusin
  • HSY3RR
  • LAP3
  • LCR1
  • LESTRCD184 antigen
  • Leukocyte-derived seven transmembrane domain receptor
  • leukocyte-derived seven-transmembrane-domain receptor
  • lipopolysaccharide-associated protein 3
  • neuropeptide Y receptor Y3
  • NPYR
  • NPYY3R
  • seven transmembrane helix receptor
  • seven-transmembrane-segment receptor, spleen
  • Stromal cell-derived factor 1 receptor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, ELISA

Publications for CXCR4 Antibody (H00007852-M02)(1)

Reviews for CXCR4 Antibody (H00007852-M02) (0)

There are no reviews for CXCR4 Antibody (H00007852-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXCR4 Antibody (H00007852-M02). (Showing 1 - 1 of 1 FAQ).

  1. Which is your best CXCR4 for immunohistochemistry in paraffin tissues? I would like to detect it in paraffin embedded tissues from human breast cancer samples.
    • CXCR4 antibody (NB100-74396) is our best selling product among all the CXCR4 antibodies and it has been validated for IHC-P in human cervical carcinoma tissue sections. NB100-74396 has been cited in at least 7 research publications. Additionally, here is a list of all of our CXCR4 antibodies that has been verified in IHC-P in human samples.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CXCR4 Antibody (H00007852-M02)

Discover related pathways, diseases and genes to CXCR4 Antibody (H00007852-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCR4 Antibody (H00007852-M02)

Discover more about diseases related to CXCR4 Antibody (H00007852-M02).

Pathways for CXCR4 Antibody (H00007852-M02)

View related products by pathway.

PTMs for CXCR4 Antibody (H00007852-M02)

Learn more about PTMs related to CXCR4 Antibody (H00007852-M02).

Research Areas for CXCR4 Antibody (H00007852-M02)

Find related products by research area.

Blogs on CXCR4.

LAMP2: Protector of the lysosome
LAMP2 belongs to the family of membrane glycoproteins who confer selectins with carbohydrate ligands. LAMP2 has been implicated in tumor cell metastasis, as well as overall protection, maintenance, and adhesion of the lysosome. It appears that LAMP2 m...  Read full blog post.

CXCR4 Studies on Neural and Stem Cells
The CXCR4 (C-X-C chemokine receptor type 4) protein is one member of the G-protein coupled receptor (GPCR1) family. As a multipass membrane protein that is found in several tissues, it is the receptor for the C-X-C chemokine CXCL12/SDF-1. The CXCR4 li...  Read full blog post.

Understanding CXCR4 and SDF1
CXCR4 (C-X-C chemokine receptor type 4) is a member of the G-protein coupled receptor (GPCR1) family. It is expressed as a multipass membrane protein in several tissues where it acts as the receptor for the C-X-C chemokine CXCL12/SDF-1. This ligand in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CXCR4 Antibody (1F8) and receive a gift card or discount.


Gene Symbol CXCR4