Recombinant Human CXCR3 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human CXCR3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-53 of Human CXCR3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CXCR3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
31.57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CXCR3 GST (N-Term) Protein

  • CD183 antigen
  • CD183
  • chemokine (C-X-C motif) receptor 3
  • chemokine (C-X-C) receptor 3
  • CKR-L2IP-10 receptor
  • CMKAR3
  • C-X-C chemokine receptor type 3
  • CXCR3
  • CXC-R3
  • CXCR-3
  • G protein-coupled receptor 9CD182
  • GPR9
  • GPR9Mig-R
  • Interferon-inducible protein 10 receptor
  • IP10 receptor
  • IP10-R
  • Mig receptor
  • MigR

Background

CD183 is a G protein-coupled receptor with selectivity for three chemokines, termed IP10 (interferon-g-inducible 10 kDa protein), Mig (monokine induced by interferon-g) and I-TAC (interferon-inducible T cell a-chemoattractant). IP10, Mig and I-TAC belong to the structural subfamily of CXC chemokines, in which a single amino acid residue separates the first two of four highly conserved Cys residues. Historically, CD183 is the third CXC chemokine receptor discovered and, therefore, commonly designated as CXCR3. Binding of chemokines to CD183 induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Inhibition by Bordetella pertussis toxin suggests that heterotrimeric G protein of the Gi-subclass couple to CD183. Signal transduction has not been further analyzed but may include the same enzymes that were identified in the signaling cascade induced by other chemokine receptors. As a consequence of chemokine-induced cellular desensitization (phosphorylation-dependent receptor internalization), cellular responses are typically rapid and short in duration. Cellular responsiveness is restored after dephosphorylation of intracellular receptors and subsequent recycling to the cell surface. A hallmark of CD183 is its prominent expression in in vitro cultured effector/memory T cells, and in T cells present in many types of inflamed tissues. In addition, IP10, Mig and I-TAC are commonly produced by local cells in inflammatory lesion, suggesting that CD183 and its chemokines participate in the recruitment of inflammatory cells. Therefore, CD183 is a target for the development of small molecular weight antagonists, which may be used in the treatment of diverse inflammatory diseases. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DIP100
Species: Hu
Applications: ELISA
DCX900
Species: Hu
Applications: ELISA
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
DCX110
Species: Hu
Applications: ELISA
485-MI
Species: Mu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
MAB1567
Species: Hu
Applications: CyTOF-reported, Flow
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB172
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
DRN00B
Species: Hu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
MAB155
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
DCP00
Species: Hu
Applications: ELISA
MAB197
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
DY417
Species: Mu
Applications: ELISA
MAB150
Species: Hu
Applications: CyTOF-ready, Flow, IHC
MCC170
Species: Mu
Applications: ELISA
H00002833-Q02
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for CXCR3 Partial Recombinant Protein (H00002833-Q02) (0)

There are no publications for CXCR3 Partial Recombinant Protein (H00002833-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXCR3 Partial Recombinant Protein (H00002833-Q02) (0)

There are no reviews for CXCR3 Partial Recombinant Protein (H00002833-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXCR3 Partial Recombinant Protein (H00002833-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CXCR3 Products

Research Areas for CXCR3 Partial Recombinant Protein (H00002833-Q02)

Find related products by research area.

Blogs on CXCR3

There are no specific blogs for CXCR3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CXCR3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CXCR3